(data stored in ACNUC30630 zone)

EMBL: AP010890.PE156

AP010890.PE156       Location/Qualifiers
FT   CDS             200685..201173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0156"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0156"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70303"
FT                   /db_xref="GOA:E8MX00"
FT                   /db_xref="UniProtKB/TrEMBL:E8MX00"
FT                   /protein_id="BAJ70303.1"
FT                   /translation="MSAGQQAVPANNANNASNEGAQKKHMSKAAVAIIAVVVVAIIVVA
FT                   GVFGFRAYSDAQYNNAVAACAAASENVRNATNDYNNLVNGDASEAAALTKKDVKDASTL
FT                   DALNKELSVELPVYEGCVADDTAGFKSATAKLNEQADWYKAYTQSLQKAVDAVNASKK"
     MSAGQQAVPA NNANNASNEG AQKKHMSKAA VAIIAVVVVA IIVVAGVFGF RAYSDAQYNN        60
     AVAACAAASE NVRNATNDYN NLVNGDASEA AALTKKDVKD ASTLDALNKE LSVELPVYEG       120
     CVADDTAGFK SATAKLNEQA DWYKAYTQSL QKAVDAVNAS KK                          162
//

If you have problems or comments...

PBIL Back to PBIL home page