(data stored in ACNUC30630 zone)

EMBL: AP010890.PE178

AP010890.PE178       Location/Qualifiers
FT   CDS             234576..235838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0178"
FT                   /product="signal recognition particle-docking protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0178"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70325"
FT                   /db_xref="GOA:E8MX22"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004390"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036225"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:E8MX22"
FT                   /protein_id="BAJ70325.1"
FT                   /translation="MLAVLGVIVAAVIVIALSIWLGKSRKRDLDRAMGKVAPDNKKTRD
FT                   AKAAADARLAAEAEEAKAATAAEPAKSAESAKAEPAPAAQAEPEPAAAPKPESQPASKP
FT                   TPAKPETPESVGSRLTRLKAKLAKSGNPFGKALFDILAKDNLSEADWEDVEDTLLLADV
FT                   GADASAQLVDDLRTDARITGKADPAEVRATLKEKLLDLVGRDTDRRLNAEKPGAAKPSV
FT                   IIMVGVNGTGKTTTAGKLARLFVAENKQVMMGAADTFRAAAADQLETWGARVNVPVVRS
FT                   DKDGADPASVAFEASAKAKEANADVLIIDTAGRLQNKSNLMDELGKIRRVTEKNLPVDE
FT                   VLLVLDATTGQNGMAQAKVFAEAIGITGVVLSKLDGSAKGGIVVSVQKELGVPVKLVGL
FT                   GEGPDDLAPFDPEGFVDGILA"
     MLAVLGVIVA AVIVIALSIW LGKSRKRDLD RAMGKVAPDN KKTRDAKAAA DARLAAEAEE        60
     AKAATAAEPA KSAESAKAEP APAAQAEPEP AAAPKPESQP ASKPTPAKPE TPESVGSRLT       120
     RLKAKLAKSG NPFGKALFDI LAKDNLSEAD WEDVEDTLLL ADVGADASAQ LVDDLRTDAR       180
     ITGKADPAEV RATLKEKLLD LVGRDTDRRL NAEKPGAAKP SVIIMVGVNG TGKTTTAGKL       240
     ARLFVAENKQ VMMGAADTFR AAAADQLETW GARVNVPVVR SDKDGADPAS VAFEASAKAK       300
     EANADVLIID TAGRLQNKSN LMDELGKIRR VTEKNLPVDE VLLVLDATTG QNGMAQAKVF       360
     AEAIGITGVV LSKLDGSAKG GIVVSVQKEL GVPVKLVGLG EGPDDLAPFD PEGFVDGILA       420
//

If you have problems or comments...

PBIL Back to PBIL home page