(data stored in ACNUC30630 zone)

EMBL: AP010890.PE182

AP010890.PE182       Location/Qualifiers
FT   CDS             complement(239810..241255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0182"
FT                   /product="putative multidrug transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0182"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70329"
FT                   /db_xref="GOA:E8MX26"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:E8MX26"
FT                   /protein_id="BAJ70329.1"
FT                   /translation="MRVSVPIDSSDAKATSSGDTTRRDGFGTPHAGANTNVSNGPTDAR
FT                   STNRRIMALALPTFGQLIAEPTFILIDTAIVGHIGDAALAGLSIGSTIILTAVGLCIFL
FT                   AYSTTAQVAHLLGAGRRRAGLQAGIDGLWLALSIGTVLGLGLFAAAEPLCRALGGQGEV
FT                   LEQAVTYTRAIVLGAPGMLMVYAANGIFRGLQKVRITLIAAVGGAVVNTVLDVLFVIVL
FT                   NWGIAGSGVATLVAQWFMGLFLVIPAILWSRADGASLRPRLAGIAAAGGDGLPLFIRTL
FT                   AIRAAMVTTVACAARMGTAVLAGFQAVNSSWNFAMNMLDSVGIAGQTLVATALGAGSVQ
FT                   QARRLTRATGRAGLVTGAVIGTAFAVVGLFAGHFFSPTPHIQTLIAVGMVTMGIFFPLQ
FT                   GWMMAIDGILIGARDYRYLAVTCTLTAVVYVTLILILANMVTPALTSDLMRTAVLWAAF
FT                   NVVLMGGRGLSNGLRVRSDAWMK"
     MRVSVPIDSS DAKATSSGDT TRRDGFGTPH AGANTNVSNG PTDARSTNRR IMALALPTFG        60
     QLIAEPTFIL IDTAIVGHIG DAALAGLSIG STIILTAVGL CIFLAYSTTA QVAHLLGAGR       120
     RRAGLQAGID GLWLALSIGT VLGLGLFAAA EPLCRALGGQ GEVLEQAVTY TRAIVLGAPG       180
     MLMVYAANGI FRGLQKVRIT LIAAVGGAVV NTVLDVLFVI VLNWGIAGSG VATLVAQWFM       240
     GLFLVIPAIL WSRADGASLR PRLAGIAAAG GDGLPLFIRT LAIRAAMVTT VACAARMGTA       300
     VLAGFQAVNS SWNFAMNMLD SVGIAGQTLV ATALGAGSVQ QARRLTRATG RAGLVTGAVI       360
     GTAFAVVGLF AGHFFSPTPH IQTLIAVGMV TMGIFFPLQG WMMAIDGILI GARDYRYLAV       420
     TCTLTAVVYV TLILILANMV TPALTSDLMR TAVLWAAFNV VLMGGRGLSN GLRVRSDAWM       480
     K                                                                       481
//

If you have problems or comments...

PBIL Back to PBIL home page