(data stored in ACNUC30630 zone)

EMBL: AP010890.PE197

AP010890.PE197       Location/Qualifiers
FT   CDS             complement(267117..267599)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0197"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0197"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70344"
FT                   /db_xref="GOA:E8MX41"
FT                   /db_xref="UniProtKB/TrEMBL:E8MX41"
FT                   /protein_id="BAJ70344.1"
FT                   /translation="MPTVLAKPTQPAAPITPGAAPVAAPGATSTTMNEQQKKIFIIVGA
FT                   VAGFLVLFGIVYGVLSSAVFSAKSVANSYVAAISSGNYDKANTIADPHVNTNQRALLTS
FT                   KASSGENTRITNARISQTSNNADGTVSAQLTYTLEGKEVNGNFTIKDNKVSVEFSE"
     MPTVLAKPTQ PAAPITPGAA PVAAPGATST TMNEQQKKIF IIVGAVAGFL VLFGIVYGVL        60
     SSAVFSAKSV ANSYVAAISS GNYDKANTIA DPHVNTNQRA LLTSKASSGE NTRITNARIS       120
     QTSNNADGTV SAQLTYTLEG KEVNGNFTIK DNKVSVEFSE                             160
//

If you have problems or comments...

PBIL Back to PBIL home page