(data stored in ACNUC30630 zone)

EMBL: AP010890.PE203

AP010890.PE203       Location/Qualifiers
FT   CDS             270189..271868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0203"
FT                   /product="putative PTS system enzyme I"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0203"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70350"
FT                   /db_xref="GOA:E8MX47"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR006318"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR008731"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR023151"
FT                   /db_xref="InterPro:IPR024692"
FT                   /db_xref="InterPro:IPR036618"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:E8MX47"
FT                   /protein_id="BAJ70350.1"
FT                   /translation="MRTIQGVSVSAGIAIGTVRVLAAVDYAVERRLIDDPQAEMDRFRA
FT                   ARDTAVAQLKQLRDNVAAEFGENKAELFDAHRLMLQDPDYAECVEGLIAQDKVNAEFAV
FT                   KSAAEQFAAMFAAMDSSTMQARAADVKDVSRRVMNVLQGKRDSTAQDGSVQGDAVQNGI
FT                   VQNGIAQNGESHIIFAEDLAPSDTAQLDRAKVLGLVTAKGSANSHTAILARTMGLPAIA
FT                   GIGDAFDPADDGHVAVIDGTSGAVFVDPDEATLTEYRRRKAEAEEHLSLLRKLKGKPTE
FT                   TKSGQRVHLYANISRPSDAAAVLANDAEGIGLFRSEFLYLEREDWPTEEFQFDAYGQVA
FT                   QEMGDRPVIIRTLDIGADKQVDYFNLSHEDNPALGYRAIRICLTRPEIFKVQLRALLRA
FT                   SAYGNIAIMLPMITSVQEVRDAKRILEEAKSELRGERIDFNESIQIGVMIETPASVIMA
FT                   DELAAEVDFFSIGTNDLTQYTLACDRQNPSLERFADPHSPAVLRMIQMTIEAAHRHGIW
FT                   CGICGELGADLSLTDTFLRLGIDELSVSPTSVLPLRNVIRNH"
     MRTIQGVSVS AGIAIGTVRV LAAVDYAVER RLIDDPQAEM DRFRAARDTA VAQLKQLRDN        60
     VAAEFGENKA ELFDAHRLML QDPDYAECVE GLIAQDKVNA EFAVKSAAEQ FAAMFAAMDS       120
     STMQARAADV KDVSRRVMNV LQGKRDSTAQ DGSVQGDAVQ NGIVQNGIAQ NGESHIIFAE       180
     DLAPSDTAQL DRAKVLGLVT AKGSANSHTA ILARTMGLPA IAGIGDAFDP ADDGHVAVID       240
     GTSGAVFVDP DEATLTEYRR RKAEAEEHLS LLRKLKGKPT ETKSGQRVHL YANISRPSDA       300
     AAVLANDAEG IGLFRSEFLY LEREDWPTEE FQFDAYGQVA QEMGDRPVII RTLDIGADKQ       360
     VDYFNLSHED NPALGYRAIR ICLTRPEIFK VQLRALLRAS AYGNIAIMLP MITSVQEVRD       420
     AKRILEEAKS ELRGERIDFN ESIQIGVMIE TPASVIMADE LAAEVDFFSI GTNDLTQYTL       480
     ACDRQNPSLE RFADPHSPAV LRMIQMTIEA AHRHGIWCGI CGELGADLSL TDTFLRLGID       540
     ELSVSPTSVL PLRNVIRNH                                                    559
//

If you have problems or comments...

PBIL Back to PBIL home page