(data stored in ACNUC30630 zone)

EMBL: AP010890.PE206

AP010890.PE206       Location/Qualifiers
FT   CDS             275739..276020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0206"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0206"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70353"
FT                   /db_xref="GOA:E8MX50"
FT                   /db_xref="InterPro:IPR003735"
FT                   /db_xref="InterPro:IPR038390"
FT                   /db_xref="UniProtKB/TrEMBL:E8MX50"
FT                   /protein_id="BAJ70353.1"
FT                   /translation="MHGYDEDKAKVIARLRRIEGQVRAITQMVEDDKYCIDILTQISAS
FT                   NSALKSVALLLLDDHLNHCVRQASIQGGEVADEKLAEASAAIARLVKS"
     MHGYDEDKAK VIARLRRIEG QVRAITQMVE DDKYCIDILT QISASNSALK SVALLLLDDH        60
     LNHCVRQASI QGGEVADEKL AEASAAIARL VKS                                     93
//

If you have problems or comments...

PBIL Back to PBIL home page