(data stored in ACNUC30630 zone)

EMBL: AP010890.PE207

AP010890.PE207       Location/Qualifiers
FT   CDS             276063..277487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0207"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0207"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70354"
FT                   /db_xref="GOA:E8MX51"
FT                   /db_xref="InterPro:IPR003798"
FT                   /db_xref="UniProtKB/TrEMBL:E8MX51"
FT                   /protein_id="BAJ70354.1"
FT                   /translation="MFEQIGTVIIVIVVLVVGAGLGLFAGFVLGRHKGQEMARGVKSEE
FT                   LEEAKTSLENARFENAELSARNAAAQAQIEGVNQQLAFAKSQLAQAQQAEQIRIQQERE
FT                   RAAAEAERKRQADAQAAEVKRAEQEARLKEQSKVLEALAPVAKNLDTLQNKVTQIEEGR
FT                   KREMGALGAQLKGLNDQQARLDKETSSLSAALRNNKVRGAWGEAQLKNIVESAGLLEHV
FT                   DFDTQVVVTDADGRTLRPDMIVHLPGGKTIPIDAKVPYADYQRACEIPDTASPEDIARR
FT                   DDLLRSHAKALREHVRALGEKAYWNAFDVAPDFVVAFIPNEALLQAALEADPTLMDDAF
FT                   SRKVALTSPVTLWAVLKSVAYAWQQQSLTDDAKQLFDLSRELYERFSTLGDYAIKLGTQ
FT                   ITKTVSAYNKFASSLERRVLPTARKLQKIEPTKIIEEVPIIESDKGNVSELSAPEVVPA
FT                   DEGDTHLTASGDSLES"
     MFEQIGTVII VIVVLVVGAG LGLFAGFVLG RHKGQEMARG VKSEELEEAK TSLENARFEN        60
     AELSARNAAA QAQIEGVNQQ LAFAKSQLAQ AQQAEQIRIQ QERERAAAEA ERKRQADAQA       120
     AEVKRAEQEA RLKEQSKVLE ALAPVAKNLD TLQNKVTQIE EGRKREMGAL GAQLKGLNDQ       180
     QARLDKETSS LSAALRNNKV RGAWGEAQLK NIVESAGLLE HVDFDTQVVV TDADGRTLRP       240
     DMIVHLPGGK TIPIDAKVPY ADYQRACEIP DTASPEDIAR RDDLLRSHAK ALREHVRALG       300
     EKAYWNAFDV APDFVVAFIP NEALLQAALE ADPTLMDDAF SRKVALTSPV TLWAVLKSVA       360
     YAWQQQSLTD DAKQLFDLSR ELYERFSTLG DYAIKLGTQI TKTVSAYNKF ASSLERRVLP       420
     TARKLQKIEP TKIIEEVPII ESDKGNVSEL SAPEVVPADE GDTHLTASGD SLES             474
//

If you have problems or comments...

PBIL Back to PBIL home page