(data stored in ACNUC30630 zone)

EMBL: AP010890.PE208

AP010890.PE208       Location/Qualifiers
FT   CDS             277556..278113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0208"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0208"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70355"
FT                   /db_xref="GOA:E8MX52"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="UniProtKB/TrEMBL:E8MX52"
FT                   /protein_id="BAJ70355.1"
FT                   /translation="MLEPREQLATLLKEHVVGRPFSELAAVTFDHRAATVMGHVLIDAL
FT                   EDAGYSIDDFDAVGALTAASVPMVSAMIQAAASRGEDLDGFVMDFVYPSIKGPSIEGRR
FT                   VVLLDAWLSEKSYVQTSSLVTLRNGNELSLDFGIVEQLGAKVVAIASLVGGGVKDINVV
FT                   NPSTGDEQTLPFIQVFDESELR"
     MLEPREQLAT LLKEHVVGRP FSELAAVTFD HRAATVMGHV LIDALEDAGY SIDDFDAVGA        60
     LTAASVPMVS AMIQAAASRG EDLDGFVMDF VYPSIKGPSI EGRRVVLLDA WLSEKSYVQT       120
     SSLVTLRNGN ELSLDFGIVE QLGAKVVAIA SLVGGGVKDI NVVNPSTGDE QTLPFIQVFD       180
     ESELR                                                                   185
//

If you have problems or comments...

PBIL Back to PBIL home page