(data stored in ACNUC30630 zone)

EMBL: AP010890.PE215

AP010890.PE215       Location/Qualifiers
FT   CDS             285781..286095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0215"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0215"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70362"
FT                   /db_xref="InterPro:IPR019592"
FT                   /db_xref="UniProtKB/TrEMBL:E8MX59"
FT                   /protein_id="BAJ70362.1"
FT                   /translation="MSAEDLDNYETDAELALYREYRDVIKLFTYVVETERRFYLANKVD
FT                   FNVRSAGQDVYFDVQLTDAWVWDVYRSSRFVKSVRIVTFKDVNVEEVQKTDIDIPDDIH
FT                   "
     MSAEDLDNYE TDAELALYRE YRDVIKLFTY VVETERRFYL ANKVDFNVRS AGQDVYFDVQ        60
     LTDAWVWDVY RSSRFVKSVR IVTFKDVNVE EVQKTDIDIP DDIH                        104
//

If you have problems or comments...

PBIL Back to PBIL home page