(data stored in ACNUC30630 zone)

EMBL: AP010890.PE221

AP010890.PE221       Location/Qualifiers
FT   CDS             293048..295132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0221"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0221"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70368"
FT                   /db_xref="UniProtKB/TrEMBL:E8MX65"
FT                   /protein_id="BAJ70368.1"
FT                   /translation="MRCGAALVSCALCVASILGGAWMSRPTPVDYGPVLATASDMYAVT
FT                   DAEGEPVRWYVVGKGGAGNGASADSGNSGSTDTDSANSNSGTSKVSRIPASAATLPWKV
FT                   SVTYSLDGPNVEANEVAGASGLIGVYIDIKPQTKEANRTIPVVAFTVPTQVADDVSADN
FT                   SITVTTQGSNTVVAAAGKAATGLEFSCYMNAKDFSMSSVALAVLPSNSSSPAVGANPDA
FT                   ANAANAAAQPAADTDVAQLTASAATLVDSLTDAGSGEQQQLIEQLQTLRDNERALNKSV
FT                   VAERETAHKRTFEDYMAAYVGSYTTHLSGSIGTSTQLPALMGTAGELSGDTPLAQAVLD
FT                   LANAVNNVSAAHQHAGAVDALDEVIRRIQQQGTTGLVDDLIAEASEEATQGSKQYADGQ
FT                   SQLSAAMIPYSMKYTDVYTANLSALTGGTSSGATAYESQAIAETNGSDELADAQSKVDA
FT                   AMSTLATASEHTGKATALRQIVLRFSDQFEGGASSASGSDGDGSSGDVSSDPVTEAQAL
FT                   TGLVDSQSQSFYGKTRVAQAKRKADAARKQAKAAQQQQSQHSKASLVDDTMSMSAGDVM
FT                   NYAGGLTSAIGGGDKSDSSKSAGSGTNDSAKSSDTGDSGNGKASDASDSGNNLDTAPVL
FT                   FGFGTGGTLFKHDMNALINETVKISDAGTLLAQAVAQLDSPNTQQKTAETRYLIVIPTV
FT                   "
     MRCGAALVSC ALCVASILGG AWMSRPTPVD YGPVLATASD MYAVTDAEGE PVRWYVVGKG        60
     GAGNGASADS GNSGSTDTDS ANSNSGTSKV SRIPASAATL PWKVSVTYSL DGPNVEANEV       120
     AGASGLIGVY IDIKPQTKEA NRTIPVVAFT VPTQVADDVS ADNSITVTTQ GSNTVVAAAG       180
     KAATGLEFSC YMNAKDFSMS SVALAVLPSN SSSPAVGANP DAANAANAAA QPAADTDVAQ       240
     LTASAATLVD SLTDAGSGEQ QQLIEQLQTL RDNERALNKS VVAERETAHK RTFEDYMAAY       300
     VGSYTTHLSG SIGTSTQLPA LMGTAGELSG DTPLAQAVLD LANAVNNVSA AHQHAGAVDA       360
     LDEVIRRIQQ QGTTGLVDDL IAEASEEATQ GSKQYADGQS QLSAAMIPYS MKYTDVYTAN       420
     LSALTGGTSS GATAYESQAI AETNGSDELA DAQSKVDAAM STLATASEHT GKATALRQIV       480
     LRFSDQFEGG ASSASGSDGD GSSGDVSSDP VTEAQALTGL VDSQSQSFYG KTRVAQAKRK       540
     ADAARKQAKA AQQQQSQHSK ASLVDDTMSM SAGDVMNYAG GLTSAIGGGD KSDSSKSAGS       600
     GTNDSAKSSD TGDSGNGKAS DASDSGNNLD TAPVLFGFGT GGTLFKHDMN ALINETVKIS       660
     DAGTLLAQAV AQLDSPNTQQ KTAETRYLIV IPTV                                   694
//

If you have problems or comments...

PBIL Back to PBIL home page