(data stored in ACNUC30630 zone)

EMBL: AP010890.PE237

AP010890.PE237       Location/Qualifiers
FT   CDS             314763..315686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0237"
FT                   /product="ATP synthase gamma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0237"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70384"
FT                   /db_xref="GOA:E8MX81"
FT                   /db_xref="InterPro:IPR000131"
FT                   /db_xref="InterPro:IPR035968"
FT                   /db_xref="UniProtKB/TrEMBL:E8MX81"
FT                   /protein_id="BAJ70384.1"
FT                   /translation="MGSQLALKSRIRSTESLAKIFNAQEMIASSHIAKARDVALNAKPY
FT                   TDAIFDAVQALVAHTHITHPIAVKDEKNPRVAVLALTSDRGMAGPYTSSIIRETESLLS
FT                   RLDAAGKQPELFVYGRRGSTYYRYRNRDIAATWEGDTDQPGVEIAETISNTLMDAYMKP
FT                   AEKGGVSELYIVYTEFINMVVQKVRVLRMLPVEIVKNETKVPDSDEEAPATADVAPLYT
FT                   FEPSLEKVLDAILPKYIQSRIHECLLTAAASETASRQNAMHTATDNARNLIDDLTRKLN
FT                   ASRQASITQELTEIIGSADALTKKEE"
     MGSQLALKSR IRSTESLAKI FNAQEMIASS HIAKARDVAL NAKPYTDAIF DAVQALVAHT        60
     HITHPIAVKD EKNPRVAVLA LTSDRGMAGP YTSSIIRETE SLLSRLDAAG KQPELFVYGR       120
     RGSTYYRYRN RDIAATWEGD TDQPGVEIAE TISNTLMDAY MKPAEKGGVS ELYIVYTEFI       180
     NMVVQKVRVL RMLPVEIVKN ETKVPDSDEE APATADVAPL YTFEPSLEKV LDAILPKYIQ       240
     SRIHECLLTA AASETASRQN AMHTATDNAR NLIDDLTRKL NASRQASITQ ELTEIIGSAD       300
     ALTKKEE                                                                 307
//

If you have problems or comments...

PBIL Back to PBIL home page