(data stored in ACNUC30630 zone)

EMBL: AP010890.PE247

AP010890.PE247       Location/Qualifiers
FT   CDS             324465..325457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0247"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0247"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70394"
FT                   /db_xref="GOA:E8MX91"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:E8MX91"
FT                   /protein_id="BAJ70394.1"
FT                   /translation="MWFRGTFPGTLRWNRWAVVRATIETMASKGKPSPRSAVSPLSDEQ
FT                   VKRLAVRHTLVDSTQYYPTGPRTPNQPEINAQNPKATKRLLGGVSIVFRASCKTKAWGL
FT                   EQVPETGPFITAASHVTMFDVFVPMMSLFHIGRRPRYMAKAEMAKWPLIGKWFQLVGMQ
FT                   PVQRHSGKAKQIEETSIDILTSGRPLTVWPEGTVTRDPKKWVMSIKEGVGYIALESSRR
FT                   LGHQVPLYPAVTWGAASINHWWPWPRKNVVMCYDHALDYSDLLADMDSWGEEPPAEAVN
FT                   ELMWRVLKRMNTVLEEIRGEQFPAEGYWDYRSMSRKPWPEAGGPFPAEK"
     MWFRGTFPGT LRWNRWAVVR ATIETMASKG KPSPRSAVSP LSDEQVKRLA VRHTLVDSTQ        60
     YYPTGPRTPN QPEINAQNPK ATKRLLGGVS IVFRASCKTK AWGLEQVPET GPFITAASHV       120
     TMFDVFVPMM SLFHIGRRPR YMAKAEMAKW PLIGKWFQLV GMQPVQRHSG KAKQIEETSI       180
     DILTSGRPLT VWPEGTVTRD PKKWVMSIKE GVGYIALESS RRLGHQVPLY PAVTWGAASI       240
     NHWWPWPRKN VVMCYDHALD YSDLLADMDS WGEEPPAEAV NELMWRVLKR MNTVLEEIRG       300
     EQFPAEGYWD YRSMSRKPWP EAGGPFPAEK                                        330
//

If you have problems or comments...

PBIL Back to PBIL home page