(data stored in ACNUC30630 zone)

EMBL: AP010890.PE293

AP010890.PE293       Location/Qualifiers
FT   CDS             382233..384503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0293"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0293"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70440"
FT                   /db_xref="GOA:E8MRP6"
FT                   /db_xref="InterPro:IPR018702"
FT                   /db_xref="UniProtKB/TrEMBL:E8MRP6"
FT                   /protein_id="BAJ70440.1"
FT                   /translation="MRIRFIRAGIVSIVATVVLAVITLAIIGTSAFGDSADLSYRTLDY
FT                   DVTATANGDLKVTQHIDVKMRERTDSDDNTKPWKQLFQQYTLNSGTLTDISDISVRNVT
FT                   DGIDYAQQSEPKLPSDVSSDKEWNSDYANHWYVADVSDGSDHPKAYTPGTDGLKPSASA
FT                   TEDDTTVEIGWNIPVTTEADSMKFDVSFTMHDVATKWKDVASFQWEPFGKKNQVPIGTV
FT                   TGTVHFPNGITGKTSWAWLHTERTSETKRNSDGSYTFTAYNIHNGDYLDVVAAFDAAKA
FT                   KGIARKGTGNHLKDLKQDEYKQQQRWLDKQRFAARARLVSWIVSIVLGIALCAWGIWAV
FT                   ISSNRRAQYRGSVEYWRDQPGISPASAARLIRVVDPSTRQSDEDRQLTATMLSLAVKKA
FT                   IAVYPGPSDMYRGIDMSQATPVGLSQMIAADQGKQYAAGITSTIVILPLAIDEAPNAQQ
FT                   LGLSESEDALLNLLIVISQRVGSPVFDLNQMKATCQNWQDGYIELGKFTGACSMEYQRL
FT                   GATRSVGWQWILPGVLAAVLGFGSLLANSFIGYPVAGLIELPIFLVGLFCSMAGAMTVL
FT                   TDQGQDIAGRTLGLKRYMEDFSNFTDRGAADLALWDWYMVYAAAFGISDRVMRELAKAY
FT                   PQVNDPAWLDANASNSLFYWNYRPYGWYSHRHNGPFDHDAAGQMDPGISGPAPAYGGTS
FT                   FAGGFSDLGSQLNSGLADISSTISAAAPSADSGGDFSSFGSGGGSGFGGSFGGSGGGSF
FT                   GGR"
     MRIRFIRAGI VSIVATVVLA VITLAIIGTS AFGDSADLSY RTLDYDVTAT ANGDLKVTQH        60
     IDVKMRERTD SDDNTKPWKQ LFQQYTLNSG TLTDISDISV RNVTDGIDYA QQSEPKLPSD       120
     VSSDKEWNSD YANHWYVADV SDGSDHPKAY TPGTDGLKPS ASATEDDTTV EIGWNIPVTT       180
     EADSMKFDVS FTMHDVATKW KDVASFQWEP FGKKNQVPIG TVTGTVHFPN GITGKTSWAW       240
     LHTERTSETK RNSDGSYTFT AYNIHNGDYL DVVAAFDAAK AKGIARKGTG NHLKDLKQDE       300
     YKQQQRWLDK QRFAARARLV SWIVSIVLGI ALCAWGIWAV ISSNRRAQYR GSVEYWRDQP       360
     GISPASAARL IRVVDPSTRQ SDEDRQLTAT MLSLAVKKAI AVYPGPSDMY RGIDMSQATP       420
     VGLSQMIAAD QGKQYAAGIT STIVILPLAI DEAPNAQQLG LSESEDALLN LLIVISQRVG       480
     SPVFDLNQMK ATCQNWQDGY IELGKFTGAC SMEYQRLGAT RSVGWQWILP GVLAAVLGFG       540
     SLLANSFIGY PVAGLIELPI FLVGLFCSMA GAMTVLTDQG QDIAGRTLGL KRYMEDFSNF       600
     TDRGAADLAL WDWYMVYAAA FGISDRVMRE LAKAYPQVND PAWLDANASN SLFYWNYRPY       660
     GWYSHRHNGP FDHDAAGQMD PGISGPAPAY GGTSFAGGFS DLGSQLNSGL ADISSTISAA       720
     APSADSGGDF SSFGSGGGSG FGGSFGGSGG GSFGGR                                 756
//

If you have problems or comments...

PBIL Back to PBIL home page