(data stored in ACNUC30630 zone)

EMBL: AP010890.PE300

AP010890.PE300       Location/Qualifiers
FT   CDS             complement(389485..391119)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0300"
FT                   /product="signal recognition particle protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0300"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70447"
FT                   /db_xref="GOA:E8MRQ3"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004125"
FT                   /db_xref="InterPro:IPR004780"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR022941"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036891"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:E8MRQ3"
FT                   /protein_id="BAJ70447.1"
FT                   /translation="MTDRLSNAFKHLKSKGKLSEADIDGTIREIRRALLDADVALDVVR
FT                   SFTGKVRERALGTEVSDALNPAQQVVKIVNEELTDVLGQGVDRPLNFAKNPPTIIMLAG
FT                   LQGAGKTTLAGKLGYWLKDSGHTPLLVAADLQRPNAVTQLQVVGERAGVPVYAPEKGIQ
FT                   SDGGEAVAAPGQTSGDPVKVARDSIELAKQKLYDTVIIDTAGRLGVDEELMKQARDIRD
FT                   AVRPNEILFVIDAMIGQDAVKTAKAFDEGVDFTGVVLSKLDGDARGGAALSVASVTGKP
FT                   ILFASNGEGLKDFEVFHPDRMASRILDMGDIMTLIEQAQKQFDEEEARKAAEKISEGSF
FT                   GLDDFLDQLQQVRKLGSMKSLLGMIPGMAQHRKELEQFDEREIDRTEAIIRSMTPAERR
FT                   DPSIINGSRRARIAYGSGVTVSQVNALLQRFEQAAKMMKRMSNRGGMGGGIPGFGGPAM
FT                   GGGKKKGKNKKKGGKSGNPMKREAEEKALRDKLAGKSSGSTGGSAFAKKPQNPALPAGL
FT                   EQMMGNVDGGTELPPNLGGGLGGLFGR"
     MTDRLSNAFK HLKSKGKLSE ADIDGTIREI RRALLDADVA LDVVRSFTGK VRERALGTEV        60
     SDALNPAQQV VKIVNEELTD VLGQGVDRPL NFAKNPPTII MLAGLQGAGK TTLAGKLGYW       120
     LKDSGHTPLL VAADLQRPNA VTQLQVVGER AGVPVYAPEK GIQSDGGEAV AAPGQTSGDP       180
     VKVARDSIEL AKQKLYDTVI IDTAGRLGVD EELMKQARDI RDAVRPNEIL FVIDAMIGQD       240
     AVKTAKAFDE GVDFTGVVLS KLDGDARGGA ALSVASVTGK PILFASNGEG LKDFEVFHPD       300
     RMASRILDMG DIMTLIEQAQ KQFDEEEARK AAEKISEGSF GLDDFLDQLQ QVRKLGSMKS       360
     LLGMIPGMAQ HRKELEQFDE REIDRTEAII RSMTPAERRD PSIINGSRRA RIAYGSGVTV       420
     SQVNALLQRF EQAAKMMKRM SNRGGMGGGI PGFGGPAMGG GKKKGKNKKK GGKSGNPMKR       480
     EAEEKALRDK LAGKSSGSTG GSAFAKKPQN PALPAGLEQM MGNVDGGTEL PPNLGGGLGG       540
     LFGR                                                                    544
//

If you have problems or comments...

PBIL Back to PBIL home page