(data stored in ACNUC30630 zone)

EMBL: AP010890.PE31

AP010890.PE31        Location/Qualifiers
FT   CDS             39963..41843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0031"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0031"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70178"
FT                   /db_xref="GOA:E8MWM5"
FT                   /db_xref="InterPro:IPR010619"
FT                   /db_xref="InterPro:IPR024528"
FT                   /db_xref="UniProtKB/TrEMBL:E8MWM5"
FT                   /protein_id="BAJ70178.1"
FT                   /translation="MKDVSEQKKKSAPEAKGATAVRKFHTHSIPLDMEDIARDWEKPVV
FT                   DAGIAAKASVIVRVGMLDLGAGTGSFRVREMMHRIAYPLGVHVRADVNLTDIEATCTDG
FT                   RNRITEVVDLPSTGVNTERIWLLEHFADWFSVNLGKGSMYHVDSQLSDGVVKHLDERDA
FT                   SQYSADLAKRLRERAKVEAEAANGSVDEALDLASKTKVLVTSVAKSLDDDNEEAHRLLA
FT                   DSAEVTPVEDKAAEEKAYDDAEVFTGDSNESVESANAANGATAESPAASSTKRKNRVPK
FT                   EYAEHFNERSDEEKAKGGITVRQAHERLDLIERRKPLYKPWFSGLASALACAAFVFLLG
FT                   GGPYDMIGAFVGAGLGQWMRRRLFAYHLNQFFVTFVCVAAAALACTGTLRLIGIFDPVA
FT                   LSHDTAYIGAMLFVIPGFPLITGGLDMAKIDFPSGIQRVAYVLCIILMATLAGWAVAVM
FT                   VHLHPEGFEPLGLDPWVNGLLRFVAAFVGVWGFSVLFNSPQRMCLTAALIGAITDTLRL
FT                   ELQDFNVAPEMATFIGAFLAGILASVWRSSVRRGWLPPHLGYPRICLTVPSIVIMVPGL
FT                   YMYRAMWYLGSFQTMNALDWAFRAFMVIICLPIGLAMARVVTDKSWRYDI"
     MKDVSEQKKK SAPEAKGATA VRKFHTHSIP LDMEDIARDW EKPVVDAGIA AKASVIVRVG        60
     MLDLGAGTGS FRVREMMHRI AYPLGVHVRA DVNLTDIEAT CTDGRNRITE VVDLPSTGVN       120
     TERIWLLEHF ADWFSVNLGK GSMYHVDSQL SDGVVKHLDE RDASQYSADL AKRLRERAKV       180
     EAEAANGSVD EALDLASKTK VLVTSVAKSL DDDNEEAHRL LADSAEVTPV EDKAAEEKAY       240
     DDAEVFTGDS NESVESANAA NGATAESPAA SSTKRKNRVP KEYAEHFNER SDEEKAKGGI       300
     TVRQAHERLD LIERRKPLYK PWFSGLASAL ACAAFVFLLG GGPYDMIGAF VGAGLGQWMR       360
     RRLFAYHLNQ FFVTFVCVAA AALACTGTLR LIGIFDPVAL SHDTAYIGAM LFVIPGFPLI       420
     TGGLDMAKID FPSGIQRVAY VLCIILMATL AGWAVAVMVH LHPEGFEPLG LDPWVNGLLR       480
     FVAAFVGVWG FSVLFNSPQR MCLTAALIGA ITDTLRLELQ DFNVAPEMAT FIGAFLAGIL       540
     ASVWRSSVRR GWLPPHLGYP RICLTVPSIV IMVPGLYMYR AMWYLGSFQT MNALDWAFRA       600
     FMVIICLPIG LAMARVVTDK SWRYDI                                            626
//

If you have problems or comments...

PBIL Back to PBIL home page