(data stored in ACNUC30630 zone)

EMBL: AP010890.PE321

AP010890.PE321       Location/Qualifiers
FT   CDS             411777..411965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0321"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0321"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70468"
FT                   /db_xref="UniProtKB/TrEMBL:E8MRS4"
FT                   /protein_id="BAJ70468.1"
FT                   /translation="MHVLHRYEEPLHDMDYTYLPLIDYELNAMQRKQFNQAFMEYGILI
FT                   PADDLSQSSSGTQALTL"
     MHVLHRYEEP LHDMDYTYLP LIDYELNAMQ RKQFNQAFME YGILIPADDL SQSSSGTQAL        60
     TL                                                                       62
//

If you have problems or comments...

PBIL Back to PBIL home page