(data stored in ACNUC30630 zone)

EMBL: AP010890.PE324

AP010890.PE324       Location/Qualifiers
FT   CDS             414123..415391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0324"
FT                   /product="peptidoglycan branched peptide synthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0324"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70471"
FT                   /db_xref="GOA:E8MRS7"
FT                   /db_xref="InterPro:IPR003447"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:E8MRS7"
FT                   /protein_id="BAJ70471.1"
FT                   /translation="MRDFVLVKLTDEEFDDFSARHPQGNFQQTSAMGRLRTAQGIDVEY
FT                   LALKEGEKIVAAALFETHRSRFSTFAVIHDGPMCDYHDTEALTFFMDALKRHAKAKGAS
FT                   QLEITPESPYRLRDTNGASLPDDQNGAPDNKLIEQLEAIGFTHGGFTVGYTAVPRWRYL
FT                   KDLTGITDEKSLLKSYDKRTQWSVKRAQSMGVHVRELSDDELGVFARIEQQTAERRSFE
FT                   YRGEAYFHRFKEAFGIKAHFMVAEIHIDEYVADMTSKREALSAKVAALTAKNAEHPTTK
FT                   TERQLGEETRNLAAAEKRLNEAAEFAKDGDVLPAAASLFVEHPREVIYLFSGSVEQYKP
FT                   FYASALIQHDAMLHFCVEHGLSRYNFYGIDGVFDDPDDEGRGVLEFKQGFNGYVEELPG
FT                   EFVLPVKPVAYAMKQFAHKLLSR"
     MRDFVLVKLT DEEFDDFSAR HPQGNFQQTS AMGRLRTAQG IDVEYLALKE GEKIVAAALF        60
     ETHRSRFSTF AVIHDGPMCD YHDTEALTFF MDALKRHAKA KGASQLEITP ESPYRLRDTN       120
     GASLPDDQNG APDNKLIEQL EAIGFTHGGF TVGYTAVPRW RYLKDLTGIT DEKSLLKSYD       180
     KRTQWSVKRA QSMGVHVREL SDDELGVFAR IEQQTAERRS FEYRGEAYFH RFKEAFGIKA       240
     HFMVAEIHID EYVADMTSKR EALSAKVAAL TAKNAEHPTT KTERQLGEET RNLAAAEKRL       300
     NEAAEFAKDG DVLPAAASLF VEHPREVIYL FSGSVEQYKP FYASALIQHD AMLHFCVEHG       360
     LSRYNFYGID GVFDDPDDEG RGVLEFKQGF NGYVEELPGE FVLPVKPVAY AMKQFAHKLL       420
     SR                                                                      422
//

If you have problems or comments...

PBIL Back to PBIL home page