(data stored in ACNUC30630 zone)

EMBL: AP010890.PE327

AP010890.PE327       Location/Qualifiers
FT   CDS             complement(418188..419189)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0327"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0327"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70474"
FT                   /db_xref="UniProtKB/TrEMBL:E8MRT0"
FT                   /protein_id="BAJ70474.1"
FT                   /translation="MSAILTPVGLLLIILAGYLFKRFGLFGQKDYRVLQTAEFNIVLPG
FT                   AIVYSFATNPHDISLLLISVFAFLFAFIPVVFIFLATRKRNVTDRAFLMLNGAGFNLGC
FT                   FSFPVVQSFWGAGAVVPAAMFDIGNCVMVAAGTNVLTQQLLHIQPGKTLAEQHAGSAPT
FT                   LPYEKPKDRDAKRLARRALLRTIGKSFFGSVPFDTYLLMIVLTVANVKIPDWIASITQP
FT                   LSGANALVSMLMVGMLMDLPQSKHDVKEVMAVIAWRIPFSVAFALIAWFLLPFSASIRA
FT                   VMVICALAPIAIFSTLFTDKVLGNAKLAGFSLAITAMISLVMMAVAHALMGV"
     MSAILTPVGL LLIILAGYLF KRFGLFGQKD YRVLQTAEFN IVLPGAIVYS FATNPHDISL        60
     LLISVFAFLF AFIPVVFIFL ATRKRNVTDR AFLMLNGAGF NLGCFSFPVV QSFWGAGAVV       120
     PAAMFDIGNC VMVAAGTNVL TQQLLHIQPG KTLAEQHAGS APTLPYEKPK DRDAKRLARR       180
     ALLRTIGKSF FGSVPFDTYL LMIVLTVANV KIPDWIASIT QPLSGANALV SMLMVGMLMD       240
     LPQSKHDVKE VMAVIAWRIP FSVAFALIAW FLLPFSASIR AVMVICALAP IAIFSTLFTD       300
     KVLGNAKLAG FSLAITAMIS LVMMAVAHAL MGV                                    333
//

If you have problems or comments...

PBIL Back to PBIL home page