(data stored in ACNUC30630 zone)

EMBL: AP010890.PE34

AP010890.PE34        Location/Qualifiers
FT   CDS             45299..46918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0034"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0034"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70181"
FT                   /db_xref="GOA:E8MWM8"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="InterPro:IPR033932"
FT                   /db_xref="UniProtKB/TrEMBL:E8MWM8"
FT                   /protein_id="BAJ70181.1"
FT                   /translation="MAGMSSLVRIVNAGVPGSQDRVDVVLRDGVVASVGPAGTVSASDS
FT                   TMQTKAHTTSLEYATNAIASGSVSIPTSAAAPADETTIDADGLWVIPGLWDCHTHFTQW
FT                   AKTLGRLDLINARSAAEAMDMLRRHLDERRAADTLDPDAFVVGMRFRHSLWADDEQPTL
FT                   AAIDAVTGEQPVALSSADMHCGWVNSAAARRLGVPVDESGLVGELEWFNAYTAFDKAPG
FT                   AAEETDRLLREAEQDAASKGVVGIRDYEMAENIDTWINRFAAGINGLRVDAGVYPERLR
FT                   AAIDAGWHTGKELPGSAGLGHVGAMKLISDGSLNTRSAYCSTPYSGIEPLTYGTLSYTP
FT                   QQIEDYMRLATEHGFDIACHAIGDEANTIALNAVAATHAHGSIEHAQMLKPVDIPRFAE
FT                   LGLTASIQPQHAMDDRDVITRFWANPAGIPYPFRALHDAGTTLRMGSDAPVAPLDPWLA
FT                   ISAAVLGTESSDREPFQPEQCLDVHTSLAASTATGRDRLASGDPADVVLLDADPYAADT
FT                   PEAMRAMPQHVVMTLLCGERTY"
     MAGMSSLVRI VNAGVPGSQD RVDVVLRDGV VASVGPAGTV SASDSTMQTK AHTTSLEYAT        60
     NAIASGSVSI PTSAAAPADE TTIDADGLWV IPGLWDCHTH FTQWAKTLGR LDLINARSAA       120
     EAMDMLRRHL DERRAADTLD PDAFVVGMRF RHSLWADDEQ PTLAAIDAVT GEQPVALSSA       180
     DMHCGWVNSA AARRLGVPVD ESGLVGELEW FNAYTAFDKA PGAAEETDRL LREAEQDAAS       240
     KGVVGIRDYE MAENIDTWIN RFAAGINGLR VDAGVYPERL RAAIDAGWHT GKELPGSAGL       300
     GHVGAMKLIS DGSLNTRSAY CSTPYSGIEP LTYGTLSYTP QQIEDYMRLA TEHGFDIACH       360
     AIGDEANTIA LNAVAATHAH GSIEHAQMLK PVDIPRFAEL GLTASIQPQH AMDDRDVITR       420
     FWANPAGIPY PFRALHDAGT TLRMGSDAPV APLDPWLAIS AAVLGTESSD REPFQPEQCL       480
     DVHTSLAAST ATGRDRLASG DPADVVLLDA DPYAADTPEA MRAMPQHVVM TLLCGERTY        539
//

If you have problems or comments...

PBIL Back to PBIL home page