(data stored in ACNUC30630 zone)

EMBL: AP010890.PE343

AP010890.PE343       Location/Qualifiers
FT   CDS             438616..438849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0344"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0344"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70490"
FT                   /db_xref="GOA:E8MRU6"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E8MRU6"
FT                   /protein_id="BAJ70490.1"
FT                   /translation="MLYGYDTVSISGAIDFLQDKYALSPALQGLVISSIMIGGVIGAGF
FT                   SGFLSDKYGRRRSTGRRAKSSTRPRLLRLLAN"
     MLYGYDTVSI SGAIDFLQDK YALSPALQGL VISSIMIGGV IGAGFSGFLS DKYGRRRSTG        60
     RRAKSSTRPR LLRLLAN                                                       77
//

If you have problems or comments...

PBIL Back to PBIL home page