(data stored in ACNUC30630 zone)

EMBL: AP010890.PE363

AP010890.PE363       Location/Qualifiers
FT   CDS             467668..467793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0365"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0365"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70510"
FT                   /db_xref="UniProtKB/TrEMBL:E8MRW6"
FT                   /protein_id="BAJ70510.1"
FT                   /translation="MQGICFCFASWDSIIANNNKSNTLIAAHGEINKSLIFQHEY"
     MQGICFCFAS WDSIIANNNK SNTLIAAHGE INKSLIFQHE Y                            41
//

If you have problems or comments...

PBIL Back to PBIL home page