(data stored in ACNUC30630 zone)

EMBL: AP010890.PE374

AP010890.PE374       Location/Qualifiers
FT   CDS             complement(478619..478792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0376"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0376"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70521"
FT                   /db_xref="UniProtKB/TrEMBL:E8MRX7"
FT                   /protein_id="BAJ70521.1"
FT                   /translation="MSKGTAQTFILGQNHQIEKSGMLLMKHIDCIVQFMGQWTVLNEDN
FT                   LLGWNCLSKHAM"
     MSKGTAQTFI LGQNHQIEKS GMLLMKHIDC IVQFMGQWTV LNEDNLLGWN CLSKHAM           57
//

If you have problems or comments...

PBIL Back to PBIL home page