(data stored in ACNUC30630 zone)

EMBL: AP010890.PE376

AP010890.PE376       Location/Qualifiers
FT   CDS             480557..482338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0378"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0378"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70523"
FT                   /db_xref="GOA:E8MRX9"
FT                   /db_xref="InterPro:IPR004433"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:E8MRX9"
FT                   /protein_id="BAJ70523.1"
FT                   /translation="MYTEIKPYQIIIQLLKERGIRHCVLSAGSRNVPFVHSIEEDPFFK
FT                   CYSITDERSAGYFALGLSQRIHEPVVISCTSSTATCNYWPPVAEAYYQHVPLIVLTGDR
FT                   DYEMLGQWEDQMIDQVGMFDRHVRKSVNLPIVRDDDDYIYCRRLVNEALLELNHNGTGP
FT                   VHINVPMKYYSTTFPLHSLPEVQAIHRVDWNSSQDEWQEKVNQLAAAKRILVVCGQESY
FT                   VSDEQQRQMTEFFHKFNSAIAVDYMSNIECEGTFNPSVCMDTRYVSDKKFEELLPGIVI
FT                   SFGGMVFSGLKAMLLRYHGKYEHWLVQEDGEVCDLFKSLTTIFACTPEYFFKYFNEHVE
FT                   NGIANDMKYHNELVDYADSVKYPDFGWSNIYAIKNVVTRIPSESLLHLSINNAIRITNF
FT                   FKLQPHVKVYANIGTHGIDGCLPSFLGQAVADSDTPSFLVIGDLSFFYGMNALRSRHIG
FT                   KNVRILLLNNHGGEEFYYNGMWRNKASDLHTTARHNAKAEGWAKSCGFTYLTASDKKSY
FT                   DAAVDQFMDSSVEGPILFEVFTEMSTDAQAIYDFYDLSRPRDFISEVKRKGKEFVKNTI
FT                   GKETALKIAGSLGVKLK"
     MYTEIKPYQI IIQLLKERGI RHCVLSAGSR NVPFVHSIEE DPFFKCYSIT DERSAGYFAL        60
     GLSQRIHEPV VISCTSSTAT CNYWPPVAEA YYQHVPLIVL TGDRDYEMLG QWEDQMIDQV       120
     GMFDRHVRKS VNLPIVRDDD DYIYCRRLVN EALLELNHNG TGPVHINVPM KYYSTTFPLH       180
     SLPEVQAIHR VDWNSSQDEW QEKVNQLAAA KRILVVCGQE SYVSDEQQRQ MTEFFHKFNS       240
     AIAVDYMSNI ECEGTFNPSV CMDTRYVSDK KFEELLPGIV ISFGGMVFSG LKAMLLRYHG       300
     KYEHWLVQED GEVCDLFKSL TTIFACTPEY FFKYFNEHVE NGIANDMKYH NELVDYADSV       360
     KYPDFGWSNI YAIKNVVTRI PSESLLHLSI NNAIRITNFF KLQPHVKVYA NIGTHGIDGC       420
     LPSFLGQAVA DSDTPSFLVI GDLSFFYGMN ALRSRHIGKN VRILLLNNHG GEEFYYNGMW       480
     RNKASDLHTT ARHNAKAEGW AKSCGFTYLT ASDKKSYDAA VDQFMDSSVE GPILFEVFTE       540
     MSTDAQAIYD FYDLSRPRDF ISEVKRKGKE FVKNTIGKET ALKIAGSLGV KLK              593
//

If you have problems or comments...

PBIL Back to PBIL home page