(data stored in ACNUC30630 zone)

EMBL: AP010890.PE382

AP010890.PE382       Location/Qualifiers
FT   CDS             490491..491705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0385"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0385"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70529"
FT                   /db_xref="GOA:E8MRY5"
FT                   /db_xref="UniProtKB/TrEMBL:E8MRY5"
FT                   /protein_id="BAJ70529.1"
FT                   /translation="MASGHLTLLAVGQVLQRSLEPAQPTDSKWGGKRNSSIELLRLLSM
FT                   LMIVSFHLCVGNRYDWFLAQPPTPTKVAYQFLMGGGWVGNFIFFTISIWFLLDRQNTLK
FT                   SSLKRIWILERELLFWSLALFAATLFLRKAGLYSGSVLKLAAHSVLPLTTSLWWYPTSY
FT                   AMFLLLLPFLVTGMKALGERAHRSLALIALLMWGIAGLLPFTRNDLHGGSVLVFVYWFV
FT                   LLSYYRWYMERISAATCWKLILAGLGIEVVYCLAFSLVFAMTGKGAGFQFFIFDNWKIP
FT                   SMFIGFGLFELFARREFHSRCVNCLAGSAFGVYLVHYHPAVKTLWMNWLPLEKLYLSAH
FT                   PLAAMTVCVLAIFACCLALDLVRQGLFAMTVDRNRGRWFELVWNKATERTKPMPVHTVP
FT                   VHTEK"
     MASGHLTLLA VGQVLQRSLE PAQPTDSKWG GKRNSSIELL RLLSMLMIVS FHLCVGNRYD        60
     WFLAQPPTPT KVAYQFLMGG GWVGNFIFFT ISIWFLLDRQ NTLKSSLKRI WILERELLFW       120
     SLALFAATLF LRKAGLYSGS VLKLAAHSVL PLTTSLWWYP TSYAMFLLLL PFLVTGMKAL       180
     GERAHRSLAL IALLMWGIAG LLPFTRNDLH GGSVLVFVYW FVLLSYYRWY MERISAATCW       240
     KLILAGLGIE VVYCLAFSLV FAMTGKGAGF QFFIFDNWKI PSMFIGFGLF ELFARREFHS       300
     RCVNCLAGSA FGVYLVHYHP AVKTLWMNWL PLEKLYLSAH PLAAMTVCVL AIFACCLALD       360
     LVRQGLFAMT VDRNRGRWFE LVWNKATERT KPMPVHTVPV HTEK                        404
//

If you have problems or comments...

PBIL Back to PBIL home page