(data stored in ACNUC30630 zone)

EMBL: AP010890.PE383

AP010890.PE383       Location/Qualifiers
FT   CDS             complement(492861..494594)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0386"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0386"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70530"
FT                   /db_xref="InterPro:IPR026487"
FT                   /db_xref="UniProtKB/TrEMBL:E8MRY6"
FT                   /protein_id="BAJ70530.1"
FT                   /translation="MTKNKLSIYLIKQDIPPEKITVEPDEDKGIMTLPVEGHDDYRLLV
FT                   RTRGEHKPTWVESFFGSSVDGECLSVENVSLVLVIPVLLECNEIGDEEFDDGSSNGMEQ
FT                   NVRYFALTFGYGRALINRSSVEERFGLKCILNTVEPNTLRAVRFADVSGSAKRSSEQLP
FT                   KAGGIDDFAFDADCNLLGQVTAKGEDGSFLSGMMTGRDSLSVTKEVNLENAEAFLRELY
FT                   KVYRKDTYKQLFDWIDRIASVKDTELINALWNEALHQISHFSEYADTNNNLWMAVPDVI
FT                   NWDDIEGFQIGNEKDPHGEPRLHNDILLGDVIRSFKKKPDSLEKLKSKKIKAISRIDGC
FT                   ILRTWSSSECLMGELNYNDKAYCICDGKWYEIQREYLERINEDIESIEEAKTSFIPFKE
FT                   DYRNSSDYKERDGKEINLENEGRYNYELTRQLNKDDNHFILMDRQLISYGGGASRIEFC
FT                   DVLSDSGQRIHVKQYSGSSVMSHLFNQGLVSASIEKDGTDFAEKVDGKIQKVGEQGHLA
FT                   QDEIDGFLLENNPVREVVFGVIQKKDNRNLPFFSKVALSSVKKQLKRMGIETKFNWIAR
FT                   E"
     MTKNKLSIYL IKQDIPPEKI TVEPDEDKGI MTLPVEGHDD YRLLVRTRGE HKPTWVESFF        60
     GSSVDGECLS VENVSLVLVI PVLLECNEIG DEEFDDGSSN GMEQNVRYFA LTFGYGRALI       120
     NRSSVEERFG LKCILNTVEP NTLRAVRFAD VSGSAKRSSE QLPKAGGIDD FAFDADCNLL       180
     GQVTAKGEDG SFLSGMMTGR DSLSVTKEVN LENAEAFLRE LYKVYRKDTY KQLFDWIDRI       240
     ASVKDTELIN ALWNEALHQI SHFSEYADTN NNLWMAVPDV INWDDIEGFQ IGNEKDPHGE       300
     PRLHNDILLG DVIRSFKKKP DSLEKLKSKK IKAISRIDGC ILRTWSSSEC LMGELNYNDK       360
     AYCICDGKWY EIQREYLERI NEDIESIEEA KTSFIPFKED YRNSSDYKER DGKEINLENE       420
     GRYNYELTRQ LNKDDNHFIL MDRQLISYGG GASRIEFCDV LSDSGQRIHV KQYSGSSVMS       480
     HLFNQGLVSA SIEKDGTDFA EKVDGKIQKV GEQGHLAQDE IDGFLLENNP VREVVFGVIQ       540
     KKDNRNLPFF SKVALSSVKK QLKRMGIETK FNWIARE                                577
//

If you have problems or comments...

PBIL Back to PBIL home page