(data stored in ACNUC30630 zone)

EMBL: AP010890.PE387

AP010890.PE387       Location/Qualifiers
FT   CDS             complement(498547..499248)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0390"
FT                   /product="putative DNA replication protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0390"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70534"
FT                   /db_xref="GOA:E8MRX4"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:E8MRX4"
FT                   /protein_id="BAJ70534.1"
FT                   /translation="MSRSLTLTRSVLAGTLAEATPNQLDFIERWFTAELDSRERSKRLR
FT                   LLKQAGFPADKTLDGYDWTNLKMPADWGRAQLENLDFVAGCEDLVLYGPVGTGKSHLAI
FT                   AIGRLACERGVPVRFFTATGLLMRLRRAQQENRLDRELASIGKARLLIIDEFGYLPIDE
FT                   EGSRLLFQIISDSYETRSIIYTTNIEFSGWGRVLGDKNMAAALIDRTVHHGRLIRFEGR
FT                   SYRSEHALMTK"
     MSRSLTLTRS VLAGTLAEAT PNQLDFIERW FTAELDSRER SKRLRLLKQA GFPADKTLDG        60
     YDWTNLKMPA DWGRAQLENL DFVAGCEDLV LYGPVGTGKS HLAIAIGRLA CERGVPVRFF       120
     TATGLLMRLR RAQQENRLDR ELASIGKARL LIIDEFGYLP IDEEGSRLLF QIISDSYETR       180
     SIIYTTNIEF SGWGRVLGDK NMAAALIDRT VHHGRLIRFE GRSYRSEHAL MTK              233
//

If you have problems or comments...

PBIL Back to PBIL home page