(data stored in ACNUC30630 zone)

EMBL: AP010890.PE394

AP010890.PE394       Location/Qualifiers
FT   CDS             505930..507366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0397"
FT                   /product="putative lipopolysaccharide biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0397"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70541"
FT                   /db_xref="GOA:E8MRZ7"
FT                   /db_xref="InterPro:IPR003856"
FT                   /db_xref="InterPro:IPR005702"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E8MRZ7"
FT                   /protein_id="BAJ70541.1"
FT                   /translation="MSIADLLQIVRKHLASAIISFVVVFAAVAAVTFIMPPKYTATAEV
FT                   FATYAGQSGETQTTNDMSSGANYLNTQITTYPELVKTEAVLQPVIKDLGLDMTTTDLAD
FT                   VVTATNPPNTFMVDISAEVGDPQQAADIANSVAKNLADQISSDLYNNSSSSGSPIKLTV
FT                   VQKAQTPTGQSSPNIPLYLAAGLILGLIVGIGVALLKDILNTKVDSTDDVRELTHASSL
FT                   GTVPQATILDDSRPVVVAQPAGSEAEEFRRIRTNLSFLTTTATQGHGRLLIITSTDPSE
FT                   GKTTVSSNVAVALAEEGKSVLLIDADLRHPSVAHKLGIEGHVGLSHVLSRQASPADVIQ
FT                   KYWKPNLHIMPAGKRPANASILLNSDLMKEMVEQALTQYDYVIIDTAPLSVANDATVFG
FT                   RMAGGLVLVTGKGVVEKKELENTATALQAAEVPILGFIFNFADPKKIHSKNYYYYYYED
FT                   GNKRSSHKGAKSKGEKKARK"
     MSIADLLQIV RKHLASAIIS FVVVFAAVAA VTFIMPPKYT ATAEVFATYA GQSGETQTTN        60
     DMSSGANYLN TQITTYPELV KTEAVLQPVI KDLGLDMTTT DLADVVTATN PPNTFMVDIS       120
     AEVGDPQQAA DIANSVAKNL ADQISSDLYN NSSSSGSPIK LTVVQKAQTP TGQSSPNIPL       180
     YLAAGLILGL IVGIGVALLK DILNTKVDST DDVRELTHAS SLGTVPQATI LDDSRPVVVA       240
     QPAGSEAEEF RRIRTNLSFL TTTATQGHGR LLIITSTDPS EGKTTVSSNV AVALAEEGKS       300
     VLLIDADLRH PSVAHKLGIE GHVGLSHVLS RQASPADVIQ KYWKPNLHIM PAGKRPANAS       360
     ILLNSDLMKE MVEQALTQYD YVIIDTAPLS VANDATVFGR MAGGLVLVTG KGVVEKKELE       420
     NTATALQAAE VPILGFIFNF ADPKKIHSKN YYYYYYEDGN KRSSHKGAKS KGEKKARK         478
//

If you have problems or comments...

PBIL Back to PBIL home page