(data stored in ACNUC30630 zone)

EMBL: AP010890.PE415

AP010890.PE415       Location/Qualifiers
FT   CDS             531015..532379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0418"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0418"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70562"
FT                   /db_xref="InterPro:IPR007841"
FT                   /db_xref="UniProtKB/TrEMBL:E8MS18"
FT                   /protein_id="BAJ70562.1"
FT                   /translation="MLNIMEVHETNQMIEQEKLDVRTITMGISLLDCASDDVDKTCDNI
FT                   YRKITTYAKDLVSTGKAIERDYGIPIVNKRITVTPISLVGASSCKTSEDFVKIAHALDK
FT                   AAKEVGVDLIGGYSALVSKSMTPAEELLIRSLPQALSETDIVCSSVNVGSTKTGIDMNA
FT                   VELLGHIIKDVAERTADNDSYGCVKFVAFCNVPDDNPFMAGGFHGVTEGDAVINVGVSG
FT                   PGVVSRALDAAKGKDFEFLCETIKRTAFKITRVGQLVAQEASRRLGIPFGIIDLSLAPT
FT                   PAVGDSVGEVLEKIGLEQVGAPGTTAALAMLNDQVKKGGIMASSYVGGLSGAFIPVSED
FT                   KNMIDAASSGCLTIEKLEAMTCVCSVGLDMIAIPGDTSAATISGMIADEAAIGMVNQKT
FT                   TAVRVIPVAGKGVGEMANFGGLMGYAPIMPVNQTSCEAFVTRGGRIPAPIHSFKN"
     MLNIMEVHET NQMIEQEKLD VRTITMGISL LDCASDDVDK TCDNIYRKIT TYAKDLVSTG        60
     KAIERDYGIP IVNKRITVTP ISLVGASSCK TSEDFVKIAH ALDKAAKEVG VDLIGGYSAL       120
     VSKSMTPAEE LLIRSLPQAL SETDIVCSSV NVGSTKTGID MNAVELLGHI IKDVAERTAD       180
     NDSYGCVKFV AFCNVPDDNP FMAGGFHGVT EGDAVINVGV SGPGVVSRAL DAAKGKDFEF       240
     LCETIKRTAF KITRVGQLVA QEASRRLGIP FGIIDLSLAP TPAVGDSVGE VLEKIGLEQV       300
     GAPGTTAALA MLNDQVKKGG IMASSYVGGL SGAFIPVSED KNMIDAASSG CLTIEKLEAM       360
     TCVCSVGLDM IAIPGDTSAA TISGMIADEA AIGMVNQKTT AVRVIPVAGK GVGEMANFGG       420
     LMGYAPIMPV NQTSCEAFVT RGGRIPAPIH SFKN                                   454
//

If you have problems or comments...

PBIL Back to PBIL home page