(data stored in ACNUC30630 zone)

EMBL: AP010890.PE420

AP010890.PE420       Location/Qualifiers
FT   CDS             539028..543065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0423"
FT                   /product="DNA-directed RNA polymerase beta' subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0423"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70567"
FT                   /db_xref="GOA:E8MS23"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/TrEMBL:E8MS23"
FT                   /protein_id="BAJ70567.1"
FT                   /translation="MLDVNAFDKIRIGLATADDIRGWSHGEVKKPETINYRTLKPEKDG
FT                   LFGEQIFGPTRDWECACGKYKRVRFKGIVCERCGVEVTRSRVRRERMGHIELAAPVTHI
FT                   WFFKGVPSRLGYLLNVTPKDLERVIYFASYMVTEVNEDERHNDLPGLQDEFDSEIKRLE
FT                   QRRDSDIEARAKKVEEDLAALEETGEAKGPARTKLRNGAERDMAAIRTRYNDQIARVDA
FT                   VFDKFKKLKPGDMVDDVDLWREMQDRYGDYFDGCMGAEAIKKRLQSLDLETISKELREE
FT                   IKDASEQRKTKALKRLKVVNAFLTTGNKPEAMVLDVIPVIPPDLRPMVQLDGGRFATSD
FT                   LNDLYRRVINRNNRLKRLIELGAPEIMLNNEKRMLQEAVDSLFDNGRRGRPVTGASNRP
FT                   LKSLSDMLKGKQGRFRQNLLGKRVDYSGRSVIVVGPSLRMHQCGLPKPMALELFKPFVI
FT                   KRLVDLNYAQNMKSAKRLVDRGDAEVWGVLEEVISEHPVLLNRAPTLHRLGIQAFEPIL
FT                   VEGKAIHLPPLACAAFNADFDGDQMAVHLPLSAEAQAEARSLMMASDNILKPADGHTVT
FT                   MPSQDMILGLYYLSTVLEGAKGQGRVFSSLEEAEMALDRHEIDMQAKVLIRLPESFVLP
FT                   KNWEPGEVKVLDPREGEDEVVKEERFHDGTVLFATSYGRILFNETLPTDYPFVNEQVAK
FT                   GRLSKIVDDIAMRYSTQQVAATLDALKDLGFTRAPWSGVSFAFSDVNEPPERDEKIAEY
FT                   EAKADKVNANYEMGLLTEEARRQELIDLWTECTAEVSKEVEEKFDPTSNLAIIVQSGAR
FT                   GNMMQINQIAGMRGLVANPKGEIIPRPVKSNYRDGLSVLEYFISQHGARKGLADTALRT
FT                   AESGYLTRRLVDVSQDVIVREEDCGTKAGLPIRVAERDNDGNLVLVKAADGGPYSRLLA
FT                   ADVIDPADGQTVLYKRDDALSMDVLNDLVAHGVEEVKCRSVLTCESKRGVCAKCYGWSL
FT                   ATNKLVDVGETVGIVAAQSIGEPGTQLTLRSFHSGGVAAASDITQGLPRVTELFEARTP
FT                   KGEAPITEFAGSIKIVENDRGRQIILTPDADSGAPKEDGVIKPITYQVSKRVPLKVADG
FT                   DHIKVGTQLVEGSVDPKKILTILGKRAAQVNIVEEVHTVYRSQGVDIHDKHIEVIVHQM
FT                   TRRVTIIDSGDTDLLPGELVDNARFREINRNIVKNGGRPAVGRPALMGITKASLATDSW
FT                   LSAASFQETTRVLTEAALSEKVDDLKGLKENVIIGKLIPAGTGLARYRNAVVEPDKAIR
FT                   DTIYPNFGLGGDGDLGDATFSDADLSDLNFSNLEFGDLKLGDDFNPDDFYSDQGGQPDI
FT                   EE"
     MLDVNAFDKI RIGLATADDI RGWSHGEVKK PETINYRTLK PEKDGLFGEQ IFGPTRDWEC        60
     ACGKYKRVRF KGIVCERCGV EVTRSRVRRE RMGHIELAAP VTHIWFFKGV PSRLGYLLNV       120
     TPKDLERVIY FASYMVTEVN EDERHNDLPG LQDEFDSEIK RLEQRRDSDI EARAKKVEED       180
     LAALEETGEA KGPARTKLRN GAERDMAAIR TRYNDQIARV DAVFDKFKKL KPGDMVDDVD       240
     LWREMQDRYG DYFDGCMGAE AIKKRLQSLD LETISKELRE EIKDASEQRK TKALKRLKVV       300
     NAFLTTGNKP EAMVLDVIPV IPPDLRPMVQ LDGGRFATSD LNDLYRRVIN RNNRLKRLIE       360
     LGAPEIMLNN EKRMLQEAVD SLFDNGRRGR PVTGASNRPL KSLSDMLKGK QGRFRQNLLG       420
     KRVDYSGRSV IVVGPSLRMH QCGLPKPMAL ELFKPFVIKR LVDLNYAQNM KSAKRLVDRG       480
     DAEVWGVLEE VISEHPVLLN RAPTLHRLGI QAFEPILVEG KAIHLPPLAC AAFNADFDGD       540
     QMAVHLPLSA EAQAEARSLM MASDNILKPA DGHTVTMPSQ DMILGLYYLS TVLEGAKGQG       600
     RVFSSLEEAE MALDRHEIDM QAKVLIRLPE SFVLPKNWEP GEVKVLDPRE GEDEVVKEER       660
     FHDGTVLFAT SYGRILFNET LPTDYPFVNE QVAKGRLSKI VDDIAMRYST QQVAATLDAL       720
     KDLGFTRAPW SGVSFAFSDV NEPPERDEKI AEYEAKADKV NANYEMGLLT EEARRQELID       780
     LWTECTAEVS KEVEEKFDPT SNLAIIVQSG ARGNMMQINQ IAGMRGLVAN PKGEIIPRPV       840
     KSNYRDGLSV LEYFISQHGA RKGLADTALR TAESGYLTRR LVDVSQDVIV REEDCGTKAG       900
     LPIRVAERDN DGNLVLVKAA DGGPYSRLLA ADVIDPADGQ TVLYKRDDAL SMDVLNDLVA       960
     HGVEEVKCRS VLTCESKRGV CAKCYGWSLA TNKLVDVGET VGIVAAQSIG EPGTQLTLRS      1020
     FHSGGVAAAS DITQGLPRVT ELFEARTPKG EAPITEFAGS IKIVENDRGR QIILTPDADS      1080
     GAPKEDGVIK PITYQVSKRV PLKVADGDHI KVGTQLVEGS VDPKKILTIL GKRAAQVNIV      1140
     EEVHTVYRSQ GVDIHDKHIE VIVHQMTRRV TIIDSGDTDL LPGELVDNAR FREINRNIVK      1200
     NGGRPAVGRP ALMGITKASL ATDSWLSAAS FQETTRVLTE AALSEKVDDL KGLKENVIIG      1260
     KLIPAGTGLA RYRNAVVEPD KAIRDTIYPN FGLGGDGDLG DATFSDADLS DLNFSNLEFG      1320
     DLKLGDDFNP DDFYSDQGGQ PDIEE                                            1345
//

If you have problems or comments...

PBIL Back to PBIL home page