(data stored in ACNUC30630 zone)

EMBL: AP010890.PE422

AP010890.PE422       Location/Qualifiers
FT   CDS             complement(543872..544387)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0425"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0425"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70569"
FT                   /db_xref="UniProtKB/TrEMBL:E8MS25"
FT                   /protein_id="BAJ70569.1"
FT                   /translation="MVDYDAAVAAVQDPNADPILLAKIAYENPEFGANVAVNPRCYPGL
FT                   KRWIAEFGDDRARETLAQYGFTAEAFGGPVQDQKATAQAAQQPAAEQAQQPAAQAAFEE
FT                   PVATNPYGFTAEQALTTTDQMQIAQIAQYAPELRACIARNPNTYPALIEWLGQLGDPAI
FT                   NAALASRQ"
     MVDYDAAVAA VQDPNADPIL LAKIAYENPE FGANVAVNPR CYPGLKRWIA EFGDDRARET        60
     LAQYGFTAEA FGGPVQDQKA TAQAAQQPAA EQAQQPAAQA AFEEPVATNP YGFTAEQALT       120
     TTDQMQIAQI AQYAPELRAC IARNPNTYPA LIEWLGQLGD PAINAALASR Q                171
//

If you have problems or comments...

PBIL Back to PBIL home page