(data stored in ACNUC30630 zone)

EMBL: AP010890.PE43

AP010890.PE43        Location/Qualifiers
FT   CDS             54639..55439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0043"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0043"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70190"
FT                   /db_xref="GOA:E8MWN7"
FT                   /db_xref="InterPro:IPR010273"
FT                   /db_xref="UniProtKB/TrEMBL:E8MWN7"
FT                   /protein_id="BAJ70190.1"
FT                   /translation="MARHVGKHGARHSLWGGVAVFVVIALTGFLLSTNVRVNRTVAATN
FT                   DTADLVEQGVDEANQLQQDVSDLTKQVANLTDALKADGTDGTDSTQNQGKDSSNVDSSL
FT                   MLPALSGSGVTVTLDDSPLWENAVNNNGTTANINDYVIHQQDVESVVNALWAGGADALM
FT                   IMDQRVLFNSAVICSGNVLSLHGKKYSPPFTISAIGDPQRLRAALNDSEAITILKQYVT
FT                   AFGIGYKVENAEDLQFPATAALLQQLKYATVDTSKTTDEEQTQQ"
     MARHVGKHGA RHSLWGGVAV FVVIALTGFL LSTNVRVNRT VAATNDTADL VEQGVDEANQ        60
     LQQDVSDLTK QVANLTDALK ADGTDGTDST QNQGKDSSNV DSSLMLPALS GSGVTVTLDD       120
     SPLWENAVNN NGTTANINDY VIHQQDVESV VNALWAGGAD ALMIMDQRVL FNSAVICSGN       180
     VLSLHGKKYS PPFTISAIGD PQRLRAALND SEAITILKQY VTAFGIGYKV ENAEDLQFPA       240
     TAALLQQLKY ATVDTSKTTD EEQTQQ                                            266
//

If you have problems or comments...

PBIL Back to PBIL home page