(data stored in ACNUC30630 zone)

EMBL: AP010890.PE436

AP010890.PE436       Location/Qualifiers
FT   CDS             574982..575896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0439"
FT                   /product="putative transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0439"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70583"
FT                   /db_xref="GOA:E8MS39"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:E8MS39"
FT                   /protein_id="BAJ70583.1"
FT                   /translation="MIAGFSITSLLLILLAGIGAGFVGYAVGASSLVSYPALLAFGIPP
FT                   VLANASNTVGVVGTGIGGVMGARKELKGQAVRSITYVVIGAFGGVAGAFLLLKLDPSVF
FT                   EFAAPVLILLSSLIIAINPRGRMQAKQAAADATAQLKHIEATEATEATEATEATEATEA
FT                   AKRATTPTAPHRPPEQLVQPMSQDSWWVWLGVAAVAIYSGYFGAGAGTLALAVLDAAKI
FT                   GSFHKINALKTLIGTGANISASVVFIIQGAVDWLAAIMLCIGCFIGGYIAPSITRKIPA
FT                   NIMRAAAVIAGIILTIDLGLKTY"
     MIAGFSITSL LLILLAGIGA GFVGYAVGAS SLVSYPALLA FGIPPVLANA SNTVGVVGTG        60
     IGGVMGARKE LKGQAVRSIT YVVIGAFGGV AGAFLLLKLD PSVFEFAAPV LILLSSLIIA       120
     INPRGRMQAK QAAADATAQL KHIEATEATE ATEATEATEA TEAAKRATTP TAPHRPPEQL       180
     VQPMSQDSWW VWLGVAAVAI YSGYFGAGAG TLALAVLDAA KIGSFHKINA LKTLIGTGAN       240
     ISASVVFIIQ GAVDWLAAIM LCIGCFIGGY IAPSITRKIP ANIMRAAAVI AGIILTIDLG       300
     LKTY                                                                    304
//

If you have problems or comments...

PBIL Back to PBIL home page