(data stored in ACNUC30630 zone)

EMBL: AP010890.PE437

AP010890.PE437       Location/Qualifiers
FT   CDS             576095..576427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0440"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0440"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70584"
FT                   /db_xref="UniProtKB/TrEMBL:E8MS40"
FT                   /protein_id="BAJ70584.1"
FT                   /translation="MLIGGSRREQVLFAGVMKELLAPINNPRYVIIGKEWGVRAYGVSF
FT                   PCPSVFARRQQDAEILSRQLDRCLTHCTMVYTRTEEGRHTLLRCQTRSFLNRDEQLPHI
FT                   LTTTSE"
     MLIGGSRREQ VLFAGVMKEL LAPINNPRYV IIGKEWGVRA YGVSFPCPSV FARRQQDAEI        60
     LSRQLDRCLT HCTMVYTRTE EGRHTLLRCQ TRSFLNRDEQ LPHILTTTSE                  110
//

If you have problems or comments...

PBIL Back to PBIL home page