(data stored in ACNUC30630 zone)

EMBL: AP010890.PE439

AP010890.PE439       Location/Qualifiers
FT   CDS             578285..578938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0442"
FT                   /product="peptide deformylase"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0442"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70586"
FT                   /db_xref="GOA:E8MS42"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/TrEMBL:E8MS42"
FT                   /protein_id="BAJ70586.1"
FT                   /translation="MFGKNAKVDLELNRDVEQLIKTGGKEKLLPIVQAGEPVLRQRTVA
FT                   YNGQLSKRTLAKLIDTMHTTMLEAPGVGLAATQIGLGLALAVVEDHVRDDEDDPREIAE
FT                   FPFHVIINPSYKPTSDKTASFYEGCLSFDGYQAVRKRWLDITAEWDDEDGKHHSEPLHG
FT                   WPARIFQHETDHLSGELYIDRAEIRSLTTNENLEDYWCEDPVPTEAAEELGFAL"
     MFGKNAKVDL ELNRDVEQLI KTGGKEKLLP IVQAGEPVLR QRTVAYNGQL SKRTLAKLID        60
     TMHTTMLEAP GVGLAATQIG LGLALAVVED HVRDDEDDPR EIAEFPFHVI INPSYKPTSD       120
     KTASFYEGCL SFDGYQAVRK RWLDITAEWD DEDGKHHSEP LHGWPARIFQ HETDHLSGEL       180
     YIDRAEIRSL TTNENLEDYW CEDPVPTEAA EELGFAL                                217
//

If you have problems or comments...

PBIL Back to PBIL home page