(data stored in ACNUC30630 zone)

EMBL: AP010890.PE444

AP010890.PE444       Location/Qualifiers
FT   CDS             583122..584045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0447"
FT                   /product="cell division protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0447"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70591"
FT                   /db_xref="GOA:E8MS47"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR004513"
FT                   /db_xref="InterPro:IPR040690"
FT                   /db_xref="UniProtKB/TrEMBL:E8MS47"
FT                   /protein_id="BAJ70591.1"
FT                   /translation="MRARFILSETWANLTRNLSMLLSLTLVTFISFLFIGASVLTQAQI
FT                   TKAKGDWYDKVEVVVWLCPDGTSQSANCASGKSPSANEITALQKTIRDELNDVVSNIDY
FT                   VSKQDFYDNTFTKQYPNGEFQGRTLTADDMQDSLWLKLKDPTKYQVVSEVLSGKEGVED
FT                   VTDQRQIFDPVFAVLNRATAVTAVLAGVMVVVAILLTGTTIRMSAASRRTETEIMRYVG
FT                   ASNWTIRLPFILEGAIASLIGSVLSCLMLSAIVNVFVTGWLAKSVTWIPYVNQLTVLVI
FT                   SPFLVVGAILLSIIASTISLRRYLRA"
     MRARFILSET WANLTRNLSM LLSLTLVTFI SFLFIGASVL TQAQITKAKG DWYDKVEVVV        60
     WLCPDGTSQS ANCASGKSPS ANEITALQKT IRDELNDVVS NIDYVSKQDF YDNTFTKQYP       120
     NGEFQGRTLT ADDMQDSLWL KLKDPTKYQV VSEVLSGKEG VEDVTDQRQI FDPVFAVLNR       180
     ATAVTAVLAG VMVVVAILLT GTTIRMSAAS RRTETEIMRY VGASNWTIRL PFILEGAIAS       240
     LIGSVLSCLM LSAIVNVFVT GWLAKSVTWI PYVNQLTVLV ISPFLVVGAI LLSIIASTIS       300
     LRRYLRA                                                                 307
//

If you have problems or comments...

PBIL Back to PBIL home page