(data stored in ACNUC30630 zone)

EMBL: AP010890.PE448

AP010890.PE448       Location/Qualifiers
FT   CDS             587386..588327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0451"
FT                   /product="putative ABC transporter substrate binding
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0451"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70595"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:E8MS51"
FT                   /protein_id="BAJ70595.1"
FT                   /translation="MQSTKLKSIMAIALSSAMLFATAACGTSDKADAGTDSAKGSDAAT
FT                   ITSYDVSSVEKDDTIAALLPESVTKDGKLTIGTNPSYAPAEFLDADGKTQIGYDMDLAR
FT                   AMGNIFGLETEIVSSNFDTIIPAIGSKYDLGIAAFTITKERMESVDFVSYFTAGMGYAV
FT                   ATGNPKNVDENDLCGLNVAVETGTVEEEAINKTAKQCKADGKKDITIQSSKQQTDATTA
FT                   VVTGKADVFFADSPVVGYAIAQTDGQLEQLGKDFDEVPNAIAIKKGDSQTTEAVQKAMQ
FT                   KLMDDGTYTKILQHWGVESGALDKAEINPAVE"
     MQSTKLKSIM AIALSSAMLF ATAACGTSDK ADAGTDSAKG SDAATITSYD VSSVEKDDTI        60
     AALLPESVTK DGKLTIGTNP SYAPAEFLDA DGKTQIGYDM DLARAMGNIF GLETEIVSSN       120
     FDTIIPAIGS KYDLGIAAFT ITKERMESVD FVSYFTAGMG YAVATGNPKN VDENDLCGLN       180
     VAVETGTVEE EAINKTAKQC KADGKKDITI QSSKQQTDAT TAVVTGKADV FFADSPVVGY       240
     AIAQTDGQLE QLGKDFDEVP NAIAIKKGDS QTTEAVQKAM QKLMDDGTYT KILQHWGVES       300
     GALDKAEINP AVE                                                          313
//

If you have problems or comments...

PBIL Back to PBIL home page