(data stored in ACNUC30630 zone)

EMBL: AP010890.PE507

AP010890.PE507       Location/Qualifiers
FT   CDS             complement(662071..663006)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0510"
FT                   /product="amino acid ABC transporter permease component"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0510"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70654"
FT                   /db_xref="GOA:E8MSB0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSB0"
FT                   /protein_id="BAJ70654.1"
FT                   /translation="MAPGHPGIQEASDIHHMTAAPTETRQHNAPDGHEVSQVELERRQY
FT                   RVHQQIQSTITSLISTIVFVVVIVIGLKLSPGWPRVKETFFSGEYFVKSFPHVLDGLWL
FT                   NIRVLLVAVVGVAILSTLIALVRTSRSPILFPLRILALIYTTVMRGVPIIVVLYLIGFG
FT                   IPGLGLFGRIDPSVLGTIAVVMGYSAYVSEVLRAGFNDVHPSQRASARSLGLTSGQTTR
FT                   LIVIPQALRKVAPALMNDFISMQKDVGLISVLGAVDAVRAAQIDVASTYNFTPYVVASL
FT                   LFILMSVPFILLNDWYTERLRKRELSGGTV"
     MAPGHPGIQE ASDIHHMTAA PTETRQHNAP DGHEVSQVEL ERRQYRVHQQ IQSTITSLIS        60
     TIVFVVVIVI GLKLSPGWPR VKETFFSGEY FVKSFPHVLD GLWLNIRVLL VAVVGVAILS       120
     TLIALVRTSR SPILFPLRIL ALIYTTVMRG VPIIVVLYLI GFGIPGLGLF GRIDPSVLGT       180
     IAVVMGYSAY VSEVLRAGFN DVHPSQRASA RSLGLTSGQT TRLIVIPQAL RKVAPALMND       240
     FISMQKDVGL ISVLGAVDAV RAAQIDVAST YNFTPYVVAS LLFILMSVPF ILLNDWYTER       300
     LRKRELSGGT V                                                            311
//

If you have problems or comments...

PBIL Back to PBIL home page