(data stored in ACNUC30630 zone)

EMBL: AP010890.PE508

AP010890.PE508       Location/Qualifiers
FT   CDS             complement(663068..663931)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0511"
FT                   /product="amino acid ABC transporter substrate binding
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0511"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70655"
FT                   /db_xref="GOA:E8MSB1"
FT                   /db_xref="InterPro:IPR001320"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSB1"
FT                   /protein_id="BAJ70655.1"
FT                   /translation="MFNKRHIVRTIAATVSILALSFTAACGSGQSTASNSTDSDDITQQ
FT                   TYKPGKLTIATGQPAYEPWVMNDKPESGEGYEAAVAYAVADKLGFKKSDVVWTRTAFDT
FT                   AIAPGAKDWDFNIQQFGITDERKKAVDFSSSYYNDSQSVVVKKDSKFANATKVSDLKDA
FT                   TVGVMVGTLAYDYAKANIKDDIQTFNDDAALAQALDAGQIDALVTSTVECVYMVQSEQV
FT                   KDAKVLGRLPDSEDKSGMGIVLPKDSKLTAAVTKAVDDLNADGTIKKLQDKWLAEYTTD
FT                   LTELKK"
     MFNKRHIVRT IAATVSILAL SFTAACGSGQ STASNSTDSD DITQQTYKPG KLTIATGQPA        60
     YEPWVMNDKP ESGEGYEAAV AYAVADKLGF KKSDVVWTRT AFDTAIAPGA KDWDFNIQQF       120
     GITDERKKAV DFSSSYYNDS QSVVVKKDSK FANATKVSDL KDATVGVMVG TLAYDYAKAN       180
     IKDDIQTFND DAALAQALDA GQIDALVTST VECVYMVQSE QVKDAKVLGR LPDSEDKSGM       240
     GIVLPKDSKL TAAVTKAVDD LNADGTIKKL QDKWLAEYTT DLTELKK                     287
//

If you have problems or comments...

PBIL Back to PBIL home page