(data stored in ACNUC30630 zone)

EMBL: AP010890.PE517

AP010890.PE517       Location/Qualifiers
FT   CDS             complement(673388..674047)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0520"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0520"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70664"
FT                   /db_xref="GOA:E8MSC0"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSC0"
FT                   /protein_id="BAJ70664.1"
FT                   /translation="MKHCDACTVDFTGDMARCPLCQNELRGEASPAAFPAQQIYLRPRR
FT                   LAVEIITFVTGAILLLHGFFSYLFSWPIPIASASAAALIISVLFINSAILHVPRPLRLM
FT                   FRYFYIMLAIALVWFVATMNHVVTMFVIPITCLVSLVFDVVLLIVLRAKAIDEYAKYLA
FT                   FDIVAGLMPLTFIPLGWAPWDVLVMVSGLVSLLVLLGLLVFARRQLFSEFGKQFSA"
     MKHCDACTVD FTGDMARCPL CQNELRGEAS PAAFPAQQIY LRPRRLAVEI ITFVTGAILL        60
     LHGFFSYLFS WPIPIASASA AALIISVLFI NSAILHVPRP LRLMFRYFYI MLAIALVWFV       120
     ATMNHVVTMF VIPITCLVSL VFDVVLLIVL RAKAIDEYAK YLAFDIVAGL MPLTFIPLGW       180
     APWDVLVMVS GLVSLLVLLG LLVFARRQLF SEFGKQFSA                              219
//

If you have problems or comments...

PBIL Back to PBIL home page