(data stored in ACNUC30630 zone)

EMBL: AP010890.PE524

AP010890.PE524       Location/Qualifiers
FT   CDS             complement(684582..685607)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0528"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0528"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70671"
FT                   /db_xref="GOA:E8MSC7"
FT                   /db_xref="InterPro:IPR001597"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSC7"
FT                   /protein_id="BAJ70671.1"
FT                   /translation="MLSFENDYSRAAHPAVLEAVAEANNHLYSGYGSDELSDQAKAKIR
FT                   EACGQPDADVWFLVGGTQTNQVVIDTITPAYAGVVAVASGHPNVHEAGAIEFSGHKVLT
FT                   IPQHNGKMDPTELDEFCKTFYADGNYEHMVFPGSVYVSQSTEYGTIYSKAELQAIADVA
FT                   HKYDMPLFVDGARLGYALTATGSDMTLADLATIADVFYIGGTKVGALFGEAVVFTKHNT
FT                   PKHFLTLIKQHGALLAKGFVLGAQFDALFTDNLYFKIARNANEAADRIREALRAKGYTL
FT                   TFEAPTNQIFVTMDQPTIDRLEREVKLGFTEKADDTHTVMRICTSWATTHEEVDQLIEL
FT                   L"
     MLSFENDYSR AAHPAVLEAV AEANNHLYSG YGSDELSDQA KAKIREACGQ PDADVWFLVG        60
     GTQTNQVVID TITPAYAGVV AVASGHPNVH EAGAIEFSGH KVLTIPQHNG KMDPTELDEF       120
     CKTFYADGNY EHMVFPGSVY VSQSTEYGTI YSKAELQAIA DVAHKYDMPL FVDGARLGYA       180
     LTATGSDMTL ADLATIADVF YIGGTKVGAL FGEAVVFTKH NTPKHFLTLI KQHGALLAKG       240
     FVLGAQFDAL FTDNLYFKIA RNANEAADRI REALRAKGYT LTFEAPTNQI FVTMDQPTID       300
     RLEREVKLGF TEKADDTHTV MRICTSWATT HEEVDQLIEL L                           341
//

If you have problems or comments...

PBIL Back to PBIL home page