(data stored in ACNUC30630 zone)

EMBL: AP010890.PE536

AP010890.PE536       Location/Qualifiers
FT   CDS             complement(697646..698182)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0540"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0540"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70683"
FT                   /db_xref="GOA:E8MSD9"
FT                   /db_xref="InterPro:IPR003691"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSD9"
FT                   /protein_id="BAJ70683.1"
FT                   /translation="MDSQSPSAGARPITHTTTPPARKLPDIHLDIVLVVFCGGAIGTAI
FT                   RYAFAQIPAAGSFHTGTFVANMLACFCYAGLTAYLAGASRFGARSKELASRGLGMGVCG
FT                   GLSTMSTLALEGFTAIRDGQVAAGIAYLLVTFALGLVCASAGVWAGTHLAGSSNVSAEA
FT                   SADTNAATTSKGGKA"
     MDSQSPSAGA RPITHTTTPP ARKLPDIHLD IVLVVFCGGA IGTAIRYAFA QIPAAGSFHT        60
     GTFVANMLAC FCYAGLTAYL AGASRFGARS KELASRGLGM GVCGGLSTMS TLALEGFTAI       120
     RDGQVAAGIA YLLVTFALGL VCASAGVWAG THLAGSSNVS AEASADTNAA TTSKGGKA         178
//

If you have problems or comments...

PBIL Back to PBIL home page