(data stored in ACNUC30630 zone)

EMBL: AP010890.PE558

AP010890.PE558       Location/Qualifiers
FT   CDS             complement(720416..721039)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0562"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0562"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70705"
FT                   /db_xref="GOA:E8MSG1"
FT                   /db_xref="InterPro:IPR021403"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSG1"
FT                   /protein_id="BAJ70705.1"
FT                   /translation="MTWNPFRKKEEAQVPVEQAPKKTADPSEKKGRPTPKMKQAQAAGI
FT                   RPLVPVDRKASAKAAKARLREKENAEYEAMQKGDINHMPKAERLPWRIYIRDYVDARFN
FT                   LGEWFIPVAFAILIVSMFVTSLMQNQWASIIMMALMYGYLIAVIIDVWLMWRKLKAKLI
FT                   AKYGEQSVSKGSRSFSYAWSRSIQMRRWRLPKPRYPKRGHWPAD"
     MTWNPFRKKE EAQVPVEQAP KKTADPSEKK GRPTPKMKQA QAAGIRPLVP VDRKASAKAA        60
     KARLREKENA EYEAMQKGDI NHMPKAERLP WRIYIRDYVD ARFNLGEWFI PVAFAILIVS       120
     MFVTSLMQNQ WASIIMMALM YGYLIAVIID VWLMWRKLKA KLIAKYGEQS VSKGSRSFSY       180
     AWSRSIQMRR WRLPKPRYPK RGHWPAD                                           207
//

If you have problems or comments...

PBIL Back to PBIL home page