(data stored in ACNUC30630 zone)

EMBL: AP010890.PE57

AP010890.PE57        Location/Qualifiers
FT   CDS             72082..72471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0057"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0057"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70204"
FT                   /db_xref="UniProtKB/TrEMBL:E8MWQ1"
FT                   /protein_id="BAJ70204.1"
FT                   /translation="MTRDTSAYPTLLHYITVYGEQTEKLLRSYVDVESSGARDQIATVR
FT                   IETIEALQVLEQTAAGELSRAVSAKTLGITADSDAIQRLARMNGYDDVAPSPVPSSAAD
FT                   EGRHAPSQTPSGGPAHQSDQKTDAQ"
     MTRDTSAYPT LLHYITVYGE QTEKLLRSYV DVESSGARDQ IATVRIETIE ALQVLEQTAA        60
     GELSRAVSAK TLGITADSDA IQRLARMNGY DDVAPSPVPS SAADEGRHAP SQTPSGGPAH       120
     QSDQKTDAQ                                                               129
//

If you have problems or comments...

PBIL Back to PBIL home page