(data stored in ACNUC30630 zone)

EMBL: AP010890.PE574

AP010890.PE574       Location/Qualifiers
FT   CDS             complement(738971..739189)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0578"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0578"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70721"
FT                   /db_xref="GOA:E8MSH7"
FT                   /db_xref="InterPro:IPR009614"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSH7"
FT                   /protein_id="BAJ70721.1"
FT                   /translation="MKPWIANKSDCLSDYQRWATYRWIQVVRIPWRQCQGYRSRRIDEK
FT                   NRIVYRITGNDVQNLEIAVCRTHYGEH"
     MKPWIANKSD CLSDYQRWAT YRWIQVVRIP WRQCQGYRSR RIDEKNRIVY RITGNDVQNL        60
     EIAVCRTHYG EH                                                            72
//

If you have problems or comments...

PBIL Back to PBIL home page