(data stored in ACNUC30630 zone)

EMBL: AP010890.PE601

AP010890.PE601       Location/Qualifiers
FT   CDS             767140..767721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0605"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0605"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70748"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSK4"
FT                   /protein_id="BAJ70748.1"
FT                   /translation="MNEDGNMNITADTANKASELRPDIDLNDPKLGLKIAAERLSIVRY
FT                   VFLVQIEDGIASAAQRASLEYADAVLIGWPETDSPEVADLDDAQLKIVREHMELMEGYI
FT                   GKYSQMEHDGDLDGMTDTLIRITERVAEVRRLYQPDFPLPTFAEIRRVVQDEWDEDMGK
FT                   IDPREDNPTAGEIEEETESADDAAGEGDQA"
     MNEDGNMNIT ADTANKASEL RPDIDLNDPK LGLKIAAERL SIVRYVFLVQ IEDGIASAAQ        60
     RASLEYADAV LIGWPETDSP EVADLDDAQL KIVREHMELM EGYIGKYSQM EHDGDLDGMT       120
     DTLIRITERV AEVRRLYQPD FPLPTFAEIR RVVQDEWDED MGKIDPREDN PTAGEIEEET       180
     ESADDAAGEG DQA                                                          193
//

If you have problems or comments...

PBIL Back to PBIL home page