(data stored in ACNUC30630 zone)

EMBL: AP010890.PE604

AP010890.PE604       Location/Qualifiers
FT   CDS             769976..773215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0608"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0608"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70751"
FT                   /db_xref="GOA:E8MSK7"
FT                   /db_xref="InterPro:IPR005372"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSK7"
FT                   /protein_id="BAJ70751.1"
FT                   /translation="MSFNDPFSILFGNGGDSRRNNANNDDPIILDVEADGDGPARNTNA
FT                   GPSGSSRPPRGPANPRITRKPASGGSGGSRGSKILIGVVLALAIIVGLFFGLSRFITDL
FT                   MWYGQLGFQSVVWTQLGVKIGLWVAYALLMALTGFVSAWLAIRARPDSADGSTIRINGD
FT                   VVEVGKSVSSKTARRVAVVISLIVGVIFGSQFNANWSEILLMFNAQSFGTTDPQFGLDN
FT                   GFYVFVLPGLKLVLAAVAMLLGVGLVFSVVTHVLMGGIRITMPVNGRGLFSITKRCRRQ
FT                   LGIWLMLNMFAWAVRQMIGVFDQLTVQGSRITGASYTAVHANIPVTFIMAALTAILGVV
FT                   LGIWLMRSHTLEGQASIGVRASAALKAWRVPVTSIAVVVVVGLVLTVAWPVLLQRFRVN
FT                   PNAQEMESTYIQRNIDATRAAYGLDKLKTEQYKVTDKGEQGALAKEGDTTAQIRLLDPQ
FT                   VVSPTFKQLQQSKQYYTFADTLAVDKYEIDGVSQDTVIAARELALAGNDNRNWVNDHTV
FT                   YTHGYGVVAAYGNKVTADGQPEFFESGIPTQGKLTESEKYEPRIYFSPNTTEYSIVGAP
FT                   EGTQAWEFDYPTGSEGALTTFKGDGGPSVGNLFSRILYAIRFGSDQILFSDRVTSESQI
FT                   LYDRSPKERVAKVAPYLTLDGRVYPAVVDGRVKWIVDGYTTSDAYPYSQMTDLGSATKD
FT                   STTVSSATVSSLGSQKANYIRNSVKATVDAYDGSVDLYVWDQSDPVIKAWEKIFPGQYH
FT                   QLSDISGDLMSHMRYPESLFKVQRELLSKYHVTSANQYYSGEDFWQTPVDPTESQSQQD
FT                   QDILQPPYYLTLQTGGTKEPVFSLTSTYIPAGQSTREILTGFLSVDSDAGNEKGKIGSN
FT                   YGTIRLQELPKDSNVPGPGQAQNNFNANADVSKELNLLQSGDTQVVRGNLLTLPLGGGL
FT                   VYVQPVYVKSSGATSFPLLKKTLVAFGDQVGFADTLDEALDQVFGGDSGAAAGDAENVS
FT                   GDGSSGDQSSGISGDQSGSDTNGGQSGTTDGKSDSGSSSDRSPELQQALNDAAQAMKDS
FT                   QSAMKNGDWTAYGKAQKELEDALNKAIELDK"
     MSFNDPFSIL FGNGGDSRRN NANNDDPIIL DVEADGDGPA RNTNAGPSGS SRPPRGPANP        60
     RITRKPASGG SGGSRGSKIL IGVVLALAII VGLFFGLSRF ITDLMWYGQL GFQSVVWTQL       120
     GVKIGLWVAY ALLMALTGFV SAWLAIRARP DSADGSTIRI NGDVVEVGKS VSSKTARRVA       180
     VVISLIVGVI FGSQFNANWS EILLMFNAQS FGTTDPQFGL DNGFYVFVLP GLKLVLAAVA       240
     MLLGVGLVFS VVTHVLMGGI RITMPVNGRG LFSITKRCRR QLGIWLMLNM FAWAVRQMIG       300
     VFDQLTVQGS RITGASYTAV HANIPVTFIM AALTAILGVV LGIWLMRSHT LEGQASIGVR       360
     ASAALKAWRV PVTSIAVVVV VGLVLTVAWP VLLQRFRVNP NAQEMESTYI QRNIDATRAA       420
     YGLDKLKTEQ YKVTDKGEQG ALAKEGDTTA QIRLLDPQVV SPTFKQLQQS KQYYTFADTL       480
     AVDKYEIDGV SQDTVIAARE LALAGNDNRN WVNDHTVYTH GYGVVAAYGN KVTADGQPEF       540
     FESGIPTQGK LTESEKYEPR IYFSPNTTEY SIVGAPEGTQ AWEFDYPTGS EGALTTFKGD       600
     GGPSVGNLFS RILYAIRFGS DQILFSDRVT SESQILYDRS PKERVAKVAP YLTLDGRVYP       660
     AVVDGRVKWI VDGYTTSDAY PYSQMTDLGS ATKDSTTVSS ATVSSLGSQK ANYIRNSVKA       720
     TVDAYDGSVD LYVWDQSDPV IKAWEKIFPG QYHQLSDISG DLMSHMRYPE SLFKVQRELL       780
     SKYHVTSANQ YYSGEDFWQT PVDPTESQSQ QDQDILQPPY YLTLQTGGTK EPVFSLTSTY       840
     IPAGQSTREI LTGFLSVDSD AGNEKGKIGS NYGTIRLQEL PKDSNVPGPG QAQNNFNANA       900
     DVSKELNLLQ SGDTQVVRGN LLTLPLGGGL VYVQPVYVKS SGATSFPLLK KTLVAFGDQV       960
     GFADTLDEAL DQVFGGDSGA AAGDAENVSG DGSSGDQSSG ISGDQSGSDT NGGQSGTTDG      1020
     KSDSGSSSDR SPELQQALND AAQAMKDSQS AMKNGDWTAY GKAQKELEDA LNKAIELDK       1079
//

If you have problems or comments...

PBIL Back to PBIL home page