(data stored in ACNUC30630 zone)

EMBL: AP010890.PE61

AP010890.PE61        Location/Qualifiers
FT   CDS             75462..76418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0061"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0061"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70208"
FT                   /db_xref="GOA:E8MWQ5"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:E8MWQ5"
FT                   /protein_id="BAJ70208.1"
FT                   /translation="MANGAQNASGTPAPAASHSGGHVVSARATTIGLMAILLWSFMAGT
FT                   VRIVSENFGATLGSALIYTVGGILLLMFRRPAPIREFPKKYLIIGGLLFVFYESSISLS
FT                   LGLASTDASSVEVSLVNYLWPTMMVLLSAGVSHRKHAVVKVLPGAIVATAGVVLAVGGN
FT                   SGLDWHAAVQHIAANPLPYALAFVGALAWSVYAVFTPAMSHGVDGTSLFFPCVAVALWI
FT                   IHFASGQGWPAEPPSLVAWLFVLIAAAAIGGGYACWGYGILHGSMERLAIASYATPVLS
FT                   TGASAVLLGLALSLPFWCGALLVAVGSVLNYLVSARK"
     MANGAQNASG TPAPAASHSG GHVVSARATT IGLMAILLWS FMAGTVRIVS ENFGATLGSA        60
     LIYTVGGILL LMFRRPAPIR EFPKKYLIIG GLLFVFYESS ISLSLGLAST DASSVEVSLV       120
     NYLWPTMMVL LSAGVSHRKH AVVKVLPGAI VATAGVVLAV GGNSGLDWHA AVQHIAANPL       180
     PYALAFVGAL AWSVYAVFTP AMSHGVDGTS LFFPCVAVAL WIIHFASGQG WPAEPPSLVA       240
     WLFVLIAAAA IGGGYACWGY GILHGSMERL AIASYATPVL STGASAVLLG LALSLPFWCG       300
     ALLVAVGSVL NYLVSARK                                                     318
//

If you have problems or comments...

PBIL Back to PBIL home page