(data stored in ACNUC30630 zone)

EMBL: AP010890.PE617

AP010890.PE617       Location/Qualifiers
FT   CDS             complement(786868..787812)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0621"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0621"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70764"
FT                   /db_xref="GOA:E8MSM0"
FT                   /db_xref="InterPro:IPR004254"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSM0"
FT                   /protein_id="BAJ70764.1"
FT                   /translation="MASTTGDSEKTMHHDAHNSATIAEDATIASKRQAAIEAREQALQA
FT                   KADAVRAKAQFKAEAIRAKAEEKARHKLAKAENRALKIEGIAPAEVERKIRLDVHGRPK
FT                   PLMRGWIHAIAAPLSLAAGIVLICLAHGASLKWACAVFMTASLILFTNSACYHLGDWSP
FT                   RVTDVLRRIDHVNIFLLIAGTYTPVSFALEPFWRNVIIISMWACTAIAIVIHVIWINAP
FT                   RWLYTVVYIIFGIYGLAYMVMFWNSPYAGPAVVVLLCAGGACYILGAIVYALRKPDPWP
FT                   RVFGFHEIFHCGTVAGYACHMVAIYMVIVSLWQ"
     MASTTGDSEK TMHHDAHNSA TIAEDATIAS KRQAAIEARE QALQAKADAV RAKAQFKAEA        60
     IRAKAEEKAR HKLAKAENRA LKIEGIAPAE VERKIRLDVH GRPKPLMRGW IHAIAAPLSL       120
     AAGIVLICLA HGASLKWACA VFMTASLILF TNSACYHLGD WSPRVTDVLR RIDHVNIFLL       180
     IAGTYTPVSF ALEPFWRNVI IISMWACTAI AIVIHVIWIN APRWLYTVVY IIFGIYGLAY       240
     MVMFWNSPYA GPAVVVLLCA GGACYILGAI VYALRKPDPW PRVFGFHEIF HCGTVAGYAC       300
     HMVAIYMVIV SLWQ                                                         314
//

If you have problems or comments...

PBIL Back to PBIL home page