(data stored in ACNUC30630 zone)

EMBL: AP010890.PE62

AP010890.PE62        Location/Qualifiers
FT   CDS             complement(76586..76819)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0062"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0062"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70209"
FT                   /db_xref="GOA:E8MWQ6"
FT                   /db_xref="UniProtKB/TrEMBL:E8MWQ6"
FT                   /protein_id="BAJ70209.1"
FT                   /translation="MTIIVTVVVVVAIVLGLGFFVNWGLAALLVIIMIPGAISLAVLAK
FT                   HPESTGGRSMFGISDPNTLLDPIRRPSERRGE"
     MTIIVTVVVV VAIVLGLGFF VNWGLAALLV IIMIPGAISL AVLAKHPEST GGRSMFGISD        60
     PNTLLDPIRR PSERRGE                                                       77
//

If you have problems or comments...

PBIL Back to PBIL home page