(data stored in ACNUC30630 zone)

EMBL: AP010890.PE623

AP010890.PE623       Location/Qualifiers
FT   CDS             793749..794069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BLIF_0627"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BLIF_0627"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ70770"
FT                   /db_xref="UniProtKB/TrEMBL:E8MSM6"
FT                   /protein_id="BAJ70770.1"
FT                   /translation="MMRKARGRRAVTVFAVAAAGRPRWLNFVDTFAAGDEGRETGISDG
FT                   LRTALRDEPEDIRARDGGMLRGAAASGAVLRVARPVFGEKLGGVRLPLSATLALAVALA
FT                   FS"
     MMRKARGRRA VTVFAVAAAG RPRWLNFVDT FAAGDEGRET GISDGLRTAL RDEPEDIRAR        60
     DGGMLRGAAA SGAVLRVARP VFGEKLGGVR LPLSATLALA VALAFS                      106
//

If you have problems or comments...

PBIL Back to PBIL home page